KEGG   Bos indicus (zebu cattle): 109570401
Entry
109570401         CDS       T04792                                 

Gene name
MTOR
Definition
(RefSeq) serine/threonine-protein kinase mTOR
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu01522  Endocrine resistance
biu04012  ErbB signaling pathway
biu04066  HIF-1 signaling pathway
biu04072  Phospholipase D signaling pathway
biu04136  Autophagy - other
biu04140  Autophagy - animal
biu04150  mTOR signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04152  AMPK signaling pathway
biu04211  Longevity regulating pathway
biu04213  Longevity regulating pathway - multiple species
biu04218  Cellular senescence
biu04371  Apelin signaling pathway
biu04613  Neutrophil extracellular trap formation
biu04630  JAK-STAT signaling pathway
biu04659  Th17 cell differentiation
biu04714  Thermogenesis
biu04910  Insulin signaling pathway
biu04919  Thyroid hormone signaling pathway
biu04920  Adipocytokine signaling pathway
biu04930  Type II diabetes mellitus
biu04931  Insulin resistance
biu04935  Growth hormone synthesis, secretion and action
biu05010  Alzheimer disease
biu05014  Amyotrophic lateral sclerosis
biu05016  Huntington disease
biu05017  Spinocerebellar ataxia
biu05022  Pathways of neurodegeneration - multiple diseases
biu05163  Human cytomegalovirus infection
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05206  MicroRNAs in cancer
biu05210  Colorectal cancer
biu05212  Pancreatic cancer
biu05214  Glioma
biu05215  Prostate cancer
biu05221  Acute myeloid leukemia
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
biu05230  Central carbon metabolism in cancer
biu05231  Choline metabolism in cancer
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109570401 (MTOR)
   04371 Apelin signaling pathway
    109570401 (MTOR)
   04630 JAK-STAT signaling pathway
    109570401 (MTOR)
   04066 HIF-1 signaling pathway
    109570401 (MTOR)
   04072 Phospholipase D signaling pathway
    109570401 (MTOR)
   04151 PI3K-Akt signaling pathway
    109570401 (MTOR)
   04152 AMPK signaling pathway
    109570401 (MTOR)
   04150 mTOR signaling pathway
    109570401 (MTOR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109570401 (MTOR)
   04136 Autophagy - other
    109570401 (MTOR)
  09143 Cell growth and death
   04218 Cellular senescence
    109570401 (MTOR)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    109570401 (MTOR)
   04659 Th17 cell differentiation
    109570401 (MTOR)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109570401 (MTOR)
   04920 Adipocytokine signaling pathway
    109570401 (MTOR)
   04935 Growth hormone synthesis, secretion and action
    109570401 (MTOR)
   04919 Thyroid hormone signaling pathway
    109570401 (MTOR)
  09149 Aging
   04211 Longevity regulating pathway
    109570401 (MTOR)
   04213 Longevity regulating pathway - multiple species
    109570401 (MTOR)
  09159 Environmental adaptation
   04714 Thermogenesis
    109570401 (MTOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109570401 (MTOR)
   05206 MicroRNAs in cancer
    109570401 (MTOR)
   05205 Proteoglycans in cancer
    109570401 (MTOR)
   05230 Central carbon metabolism in cancer
    109570401 (MTOR)
   05231 Choline metabolism in cancer
    109570401 (MTOR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109570401 (MTOR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109570401 (MTOR)
   05212 Pancreatic cancer
    109570401 (MTOR)
   05225 Hepatocellular carcinoma
    109570401 (MTOR)
   05226 Gastric cancer
    109570401 (MTOR)
   05214 Glioma
    109570401 (MTOR)
   05221 Acute myeloid leukemia
    109570401 (MTOR)
   05215 Prostate cancer
    109570401 (MTOR)
   05224 Breast cancer
    109570401 (MTOR)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109570401 (MTOR)
   05014 Amyotrophic lateral sclerosis
    109570401 (MTOR)
   05016 Huntington disease
    109570401 (MTOR)
   05017 Spinocerebellar ataxia
    109570401 (MTOR)
   05022 Pathways of neurodegeneration - multiple diseases
    109570401 (MTOR)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    109570401 (MTOR)
   04931 Insulin resistance
    109570401 (MTOR)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109570401 (MTOR)
   05168 Herpes simplex virus 1 infection
    109570401 (MTOR)
   05163 Human cytomegalovirus infection
    109570401 (MTOR)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109570401 (MTOR)
   05165 Human papillomavirus infection
    109570401 (MTOR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109570401 (MTOR)
   01522 Endocrine resistance
    109570401 (MTOR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109570401 (MTOR)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109570401 (MTOR)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109570401 (MTOR)
Protein kinases [BR:biu01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   109570401 (MTOR)
Membrane trafficking [BR:biu04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    109570401 (MTOR)
SSDB
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 UME V-ATPase_H_N EPSP_synthase HEAT_EZ Nipped-B_C
Other DBs
NCBI-GeneID: 109570401
NCBI-ProteinID: XP_019831887
UniProt: A0A6P5D4K7
LinkDB
Position
16
AA seq 2574 aa
MKRRYRRGRRQLRPWPKPREPQGKMLGTGPAAATTAATTSSNVSVLQQFASGLKSRNEET
RAKAAKELQHYVTMELREMSQEESTRFYDQLNHHIFELVSSSDANERKGGILAIASLIGV
EGGNATRIGRFANYLRNLLPSNDPVVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWL
GADRNEGRRHAAVLVLRELAISVPTFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRAC
LILTTQREPKEMQKPQWYRHTFEEAEKGFDETLAKEKGMNRDDRIHGALLILNELVRISS
MEGERLREEMEEITQQQLVHDKYCKDLMGFGTKPRHITPFTSFQSVQPQQSNALVGLLGY
SSHQGLMGFGASPSPAKSMLVESRCCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLL
PRLAAFRPSAFTDTQYLQDTMNHVLSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVL
DIIRAALPPKDFAHKRQKAMQVDATVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPA
LTAVLYDLSRQIPQLKKDIQDGLLKMLSLVLMHKPLRHPGMPKGLAHQLASPGLTTLPEA
SDVGSITLALRTLGSFEFEGHSLTQFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSVHL
ISGHAHVVSQTAVQVVADVLSKLLVVGITDPDPDIRYCVLASLDERFDAHLAQAENLQAL
FVALNDQVFEIRELAICTVGRLSSMNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARM
LGHLVSNAPRLIRPYMEPILKALILKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKW
VDELFIIIMDMLQDSSLLAKRQVALWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQ
NQGTRREAIRVLGLLGALDPYKHKVNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLV
NMGNLPLDEFYPAVSMVALMRIFRDQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPT
FLNVIRVCDGAIREFLFQQLGMLVSFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLI
EQIVVALGGEFKLYLPQLIPHMLRVFMHDNSSGRIVSIKLLAAIQLFGANLDDYLHLLLP
PIVKLFDAPEAPLPSRKAALETVDRLTESLDFTDYASRIIHPIVRTLDQSPELRSTAMDT
LSSLVFQLGKKYQIFIPMVNKVLVRHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRM
LRSGQGDALASGPVETGPMKKLHVSTINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSS
SPSLRSCWALAQAYNPMARDLFNAAFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQT
LLNLAEFMEHSDKGPLPLRDDNGIVLLGERAAKCRAYAKALHYKELEFQKGPTPAILESL
ISINNKLQQPEAAAGVLEYAMKHFGELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPEL
MLGRMRCLEALGEWGQLHQQCCEKWTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMI
PRDTHDGAFYRAVLALHQDLFSLAQQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHML
SELEEVIQYKLVPERREIIRQIWWERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKY
ASLCGKSGRLALAHKTLVLLLGVDPSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQH
MQHFVQTMQQQAQHAIATEDQQHKQELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYY
SAATEHDRSWYKAWHAWAVMNFEAVLHYKHQNQARDEKKKLRHASGANITNAATAATTAA
TATATTTSTEGSNSESEAESTENSPTPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLS
RGNNLQDTLRVLTLWFDYGHWPDVNEALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGR
LIHQLLTDIGRYHPQALIYPLTVASKSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEE
LIRVAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYG
RDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRD
LELAVPGTYDPNQPIIRIQSIAPSLQVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQD
ERVMQLFGLVNTLLANDPTSLRKNLSIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYRE
KKKILLNIEHRIMLRMAPDYDHLTLMQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFD
RRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKI
PFRLTRMLTNAMEVTGLDGNYRITCHTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTN
TKGNKRSRTRTDSYSAGQSVEILDGVELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNK
KAIQIINRVRDKLTGRDFSHDETLDVPTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7725 nt   +upstreamnt  +downstreamnt
atgaagaggcggtaccggcgcgggcggcggcagttgaggccttggccgaagccgcgcgaa
cctcagggcaagatgcttggaaccggccctgctgctgccaccacagctgccaccacatcc
agcaatgtgagcgtcctgcagcagtttgccagcggcctgaagagccggaatgaagagact
agggccaaagctgccaaggagctccagcactacgtcaccatggagctccgagagatgagt
caagaggagtctactcgcttctatgatcagctgaaccatcacatctttgaactggtgtcc
agctcagatgccaatgagaggaaaggtggcattttggccatagccagcctcataggagtg
gaaggtgggaatgccactcgaattggaagatttgctaactaccttcggaacctccttccc
tccaacgacccagttgtcatggaaatggcatccaaggccatcggtcggctcgccatggca
ggggacactttcactgctgagtatgtggagtttgaggtgaagcgagccctggaatggctg
ggtgctgaccgcaatgagggccggagacacgcggctgtcctggtgctccgtgagctggcc
atcagcgtccccaccttcttcttccagcaagtgcagcccttctttgataatatttttgtg
gccgtgtgggaccccaaacaggccatccgggaaggagctgtcgccgcccttcgtgcctgt
ctgatcctcaccacccagcgggagccaaaagagatgcagaagccgcagtggtacaggcac
acgtttgaagaagcagagaaagggtttgatgagaccttggccaaggagaagggcatgaat
cgggatgaccggatccatggagccctgcttatcctcaatgagctggtccggatcagtagc
atggagggagagcgcctgagagaagaaatggaagaaatcacacagcagcagttggtccat
gacaagtactgcaaggatctcatgggttttggaacgaaaccccgtcacatcacccccttc
accagtttccagtccgtgcagccccagcagtcaaatgccttggtggggctgctggggtac
agctctcaccaaggcctcatgggctttggggcctcccccagcccagcaaagtccatgctg
gtggaaagtcgctgctgcagggacttgatggaggagaaatttgatcaggtgtgccagtgg
gtgctgaagtgcaggaatagcaagaactcgctgatccaaatgacaatccttaatttgttg
ccccgcttggctgccttccgaccttctgccttcacagatacccagtacctccaggatacc
atgaaccatgtcctgagctgcgtcaagaaggagaaggaacggacagcagcctttcaagcc
ctggggctactttctgtggctgtgaggtctgagttcaaggtctatttacctcgtgtgctg
gacatcatccgagcagccctgccccctaaggacttcgcccataagagacagaaggctatg
caagtggatgccacagtgttcacctgcatcagcatgctggcccgagccatggggccaggc
atccaacaggacatcaaggagctgctggagcccatgctggcggtgggcctgagccctgcc
ctcacagctgtgctctatgacctgagccgtcagattccacagctgaaaaaggacatccaa
gacgggctcctgaagatgctgtccctggtccttatgcacaaacccctccggcaccccggc
atgcccaagggcctggcccatcagctggcttcccctggtctcacgaccctccctgaggcc
agtgatgtgggcagcatcacccttgctctccgaactctcggcagttttgaatttgaaggc
cactctctgacccagtttgtccgccactgtgcggatcacttcctgaacagcgagcacaag
gagatccgtatggaggccgcccgcacctgctcccgcctgctcacaccctctgtccacctc
atcagtggccacgctcatgtggtcagccagactgcagtgcaagtggtggcagatgtgctc
agcaaactgctcgtggttgggataaccgatcctgaccccgacatccgctactgtgtcttg
gcgtccctggacgagcgctttgatgcacacctggcccaggcggagaacctgcaggccctg
tttgtggctctgaatgaccaggtgtttgagatccgggagctggccatctgcactgtgggc
cggctcagcagcatgaacccagccttcgtcatgcccttcctgcgcaagatgctcatccag
attctcacagagctggagcacagcggcattggaagaatcaaggagcagagtgcccgcatg
ctgggccacctggtctccaacgccccgcggctcatccgcccctacatggagcctattctg
aaggctttaattttgaaactgaaagatccagaccctgatccaaacccaggtgtgatcaat
aatgtcttggctacgataggagagttggctcaggttagtggccttgaaatgaggaaatgg
gttgatgaactttttattatcatcatggacatgctccaagactcctctctgttggccaaa
aggcaggtggctctgtggaccttggggcagttggtggccagcactggctacgtggtagag
ccctacaggaagtaccccacattgctggaggtgctgctgaactttctgaagactgagcaa
aaccagggtacacggcgggaggctatccgtgtgttggggctcctaggggcattggatccc
tacaagcacaaagtgaacattggcatgatcgaccagtcccgggacgcttctgccgtcagc
ctgtcagagtccaagtcaagtcaggattcttctgactacagcaccagcgagatgctggtc
aacatggggaacctgcctctagacgagttctacccggccgtgtccatggtggccctgatg
cgcatcttccgagaccagtccctctctcaccaccacaccatggttgtccaggctatcacc
ttcatcttcaagtccctggggctcaagtgcgtgcagttcctgccccaggtcatgcccaca
ttcctgaatgtcattcgggtttgtgacggggccatccgggaatttctgttccagcagctg
ggaatgttggtgtcctttgtgaagagccacatcagaccttacatggatgagatagtcacg
ctcatgagagaattctgggtcatgaacacctccatccagagcacaatcattctcctcatt
gagcagattgtggtagccctcgggggtgaatttaagctctacctgccccagctgattcca
cacatgcttcgtgtcttcatgcatgacaatagctcaggccgcatcgtctccatcaagttg
ctggctgcaatccagctgttcggtgccaacctggatgactatctgcatttgttgctgccc
ccgatcgtgaagttatttgacgcccccgaagccccattgccttctcgaaaggccgcgcta
gagactgtggaccgtctgacagagtctctggatttcacggactatgcctctcggatcatt
catccgattgtacgcacactggaccagagcccagaactccgttccacagcaatggacacg
ttgtcttcactcgtctttcagctgggaaagaagtaccaaattttcattccaatggtgaac
aaagttctggtgagacaccgaatcaaccatcagcgctacgatgtcctcatctgcaggata
gtcaaggggtataccctggctgacgaggaggaggaccctctgatttaccagcatcgaatg
ctgaggagcggccaaggtgatgccttagccagtggaccagtggaaacggggcccatgaag
aaactgcacgtcagcaccatcaacctccaaaaggcctggggagctgccagaagggtttcc
aaagatgattggttggaatggctgcggcggctgagcctggagctgctgaaggactcctcg
tcaccctccctgcgctcctgctgggccctggcacaggcctacaacccgatggccagggat
ctctttaacgctgcgtttgtgtcctgctggtctgagctgaatgaggaccagcaggatgag
ctcatcagaagtatcgagttggccctcacctcccaggacatcgcagaagtcacgcaaacc
ctcttaaatttggctgaattcatggaacacagtgacaagggccccctgcctttgagagat
gacaatggcattgtcctgctgggcgagagagctgccaagtgccgagcatatgccaaagcg
ctgcactacaaagaactggagttccagaaaggtcccacccctgccattctcgagtctctc
atcagcattaataataagctgcagcagccagaggcagctgctggggtgttggagtatgcc
atgaagcactttggagagctggagatccaggctacctggtatgagaagctgcacgagtgg
gaagatgctctcgtggcctatgataagaaaatggacaccaacaaggacgacccagagctg
atgctgggccgcatgcgctgcctcgaggccttgggggaatgggggcagcttcaccagcag
tgctgtgaaaaatggactctggttaatgatgagacccaagccaagatggcccgcatggct
gctgcagctgcatggggtttaggtcagtgggacagcatggaagagtacacgtgtatgatc
cctcgggacacccacgacggggcattttatagagctgtgctggcgctacatcaggacctc
ttctccttggcacaacagtgcatcgacaaagcccgggacctactagacgcggagttaacg
gcgatggcgggagagagctacagccgggcctatggggccatggtttcttgccacatgctg
tctgagctggaggaggttatccagtacaaacttgtgcccgagcgacgggagatcatccgc
cagatctggtgggagagactgcagggctgccagcgtattgtggaagactggcagaaaatc
ctcatggtgcggtcactcgtcgtcagccctcacgaggacatgaggacctggctcaagtac
gcaagcctgtgtggcaagagtggcaggctggcacttgctcacaaaaccttagtgctgctc
ctgggagttgatccatctcggcaacttgaccatcctctgccaacggttcacccccaggtg
acctacgcctacatgaaaaatatgtggaagagcgcccgcaagattgatgccttccagcac
atgcagcactttgttcagaccatgcagcagcaagcccagcatgccatcgccaccgaggac
cagcagcacaagcaggagctgcacaagctcatggcccgatgtttcctgaaactcggggag
tggcagctgaacctacagggcatcaacgagagcacgatccccaaagtcctgcagtactac
agcgccgccacagagcacgaccgcagctggtacaaggcctggcacgcgtgggcagtgatg
aactttgaggctgtgctccactacaaacatcagaaccaagcccgcgacgagaagaagaag
ctgcgacacgccagtggggccaacatcactaacgcagccactgctgctaccacagcggcc
acggccaccgccaccaccaccagcaccgagggcagcaacagcgagagcgaggctgagagc
accgagaacagccctaccccgtctcctctgcagaagaaggtcactgaggatttgtccaaa
accctcttgatgtacactgtccctgctgtccagggcttcttccgttccatctccttgtca
cgaggcaacaacctccaggacacgctcagagtcctcaccttatggtttgattatggtcac
tggccagatgtaaatgaagccttagtggaaggggtgaaagcaatccagattgacacttgg
ttacaggttatacctcagctcattgcaagaattgatacgccaaggcccctggtgggacgt
cttatccaccagcttctcacagacattggtcggtaccacccccaggccctcatctaccca
ctgacagtggcctccaagtccaccaccacagcccggcacaacgcagccaacaaaatcctg
aagaacatgtgcgaacacagcaacaccctggtgcagcaggccatgatggtgagtgaggag
ctgatccgagtggccatcctctggcacgagatgtggcatgaaggcctggaagaggcgtct
cgcttgtactttggggagaggaacgtgaaaggcatgttcgaggtgctggaacccctgcac
gccatgatggagcggggaccccagacactgaaggaaacatcctttaaccaggcatatggt
cgagatttaatggaggcccaggaatggtgcaggaagtacatgaaatcagggaatgtcaag
gacctcacccaagcctgggacctctattaccacgtattcagacgaatctccaagcagctg
cctcagctcacatccttagagctgcagtacgtctcccccaaacttctgatgtgccgggat
ctggaactggctgtgccgggaacttacgaccccaaccagcccatcattcgcattcagtcc
atcgcgccgtctctgcaagtcatcacatccaaacagaggccccggaagctgacgcttatg
ggcagcaacgggcacgagtttgtcttcctcctgaagggccatgaggacttgcggcaggac
gaacgggtgatgcagctcttcggcctggtcaacacccttctggccaatgacccgacgtct
cttcggaaaaacctcagcatccagagatacgctgtcattccattatcaaccaactcgggc
ctcatcggctgggtcccccactgtgacacactgcacgccctcatccgggactacagggag
aaaaagaagatccttctcaacattgagcatcgcatcatgctgcggatggctccagactat
gaccacctaactctgatgcagaaggtcgaggtgtttgagcacgccgtcaacaacacagct
ggggacgacctggccaaactgctgtggctgaagagccccagctccgaggtgtggtttgat
cgaagaaccaattatacccgctctttagcggtcatgtctatggttgggtatattttgggc
ctgggcgatagacacccatccaacctgatgctggaccggctgagtggaaagatcctgcac
attgactttggggactgctttgaggttgctatgaccagagagaaattcccagagaaaatt
ccatttagactaacaagaatgctgaccaatgctatggaggtcacgggccttgatggcaac
tacaggatcacgtgccacaccgtgatggaggtgctccgggagcacaaggacagcgtcatg
gccgtgctggaagccttcgtctatgaccccctgctgaactggaggctgatggacacaaat
accaaaggtaacaagcgatcacggacgaggacagattcctactctgctggccagtcagta
gaaattttggatggtgtggaacttggggaaccagcccataagaaaacggggaccacagtg
ccagaatctattcattctttcatcggagatggcttggtgaaaccagaggccctcaataag
aaagcaattcaaattattaacagggttcgagacaagctcactggtcgggacttctctcat
gacgaaaccctggatgtcccaacacaagtcgagctgctcatcaaacaagcgacatcccat
gaaaacctctgccagtgctacattggctggtgtcctttctggtaa

DBGET integrated database retrieval system