KEGG   Bos indicus (zebu cattle): 109570573Help
Entry
109570573         CDS       T04792                                 

Gene name
PARK7
Definition
(RefSeq) protein deglycase DJ-1
  KO
K05687  protein DJ-1 [EC:3.5.1.124]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05012 Parkinson disease
    109570573 (PARK7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:biu01002]
    109570573 (PARK7)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109570573 (PARK7)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.124  protein deglycase
     109570573 (PARK7)
Peptidases [BR:biu01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   109570573 (PARK7)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109570573 (PARK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DJ-1_PfpI ThiJ_like GATase_3
Motif
Other DBs
NCBI-GeneID: 109570573
NCBI-ProteinID: XP_019832188
LinkDB All DBs
Position
16
AA seq 189 aa AA seqDB search
MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLED
AKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQEKRKGLIAAICAGPTALLAHEIGFG
SKVTTHPLAKDKMMNGSHYSYSENRVEKDGLILTSRGPGTSFEFALKIVEVLVGKEVADQ
VKAPLVLKD
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaaaaagagctctagtcatcctggctaaaggagcagaggaaatggagacggtt
atccctgtagatgtcatgagacgagctggaattaaggtcaccgttgcaggtctggctgga
aaagacccggtacagtgtagccgagatgttgtcatttgtcctgatgcaagtctggaagat
gcaaaaaaagagggaccttatgatgtggtggttcttccaggaggtaatctgggtgcacag
aatttatccgagtccgctgctgtgaaggagatactgaaggaacaagagaagaggaagggc
ctcatcgctgccatctgtgcaggtcctacagctctgctggctcatgaaataggttttgga
agcaaagttacaacacacccacttgctaaagacaaaatgatgaacggaagtcattacagc
tactccgagaaccgtgtggaaaaggatggcctgatccttaccagccgggggccaggaacc
agctttgagtttgctctgaagatcgtcgaggtgctggttggcaaggaggtggccgaccaa
gtgaaggccccgctggttcttaaagattaa

DBGET integrated database retrieval system