KEGG   Bos indicus (zebu cattle): 109570734Help
Entry
109570734         CDS       T04792                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00590  Arachidonic acid metabolism
biu01100  Metabolic pathways
biu04064  NF-kappa B signaling pathway
biu04370  VEGF signaling pathway
biu04625  C-type lectin receptor signaling pathway
biu04657  IL-17 signaling pathway
biu04668  TNF signaling pathway
biu04723  Retrograde endocannabinoid signaling
biu04726  Serotonergic synapse
biu04913  Ovarian steroidogenesis
biu04921  Oxytocin signaling pathway
biu04923  Regulation of lipolysis in adipocytes
biu05140  Leishmaniasis
biu05163  Human cytomegalovirus infection
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05200  Pathways in cancer
biu05204  Chemical carcinogenesis
biu05206  MicroRNAs in cancer
biu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    109570734 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    109570734 (PTGS2)
   04064 NF-kappa B signaling pathway
    109570734 (PTGS2)
   04668 TNF signaling pathway
    109570734 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109570734 (PTGS2)
   04657 IL-17 signaling pathway
    109570734 (PTGS2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    109570734 (PTGS2)
   04913 Ovarian Steroidogenesis
    109570734 (PTGS2)
   04921 Oxytocin signaling pathway
    109570734 (PTGS2)
  09156 Nervous system
   04726 Serotonergic synapse
    109570734 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    109570734 (PTGS2)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    109570734 (PTGS2)
   05206 MicroRNAs in cancer
    109570734 (PTGS2)
   05204 Chemical carcinogenesis
    109570734 (PTGS2)
   05222 Small cell lung cancer
    109570734 (PTGS2)
  09167 Infectious diseases
   05163 Human cytomegalovirus infection
    109570734 (PTGS2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109570734 (PTGS2)
   05165 Human papillomavirus infection
    109570734 (PTGS2)
   05140 Leishmaniasis
    109570734 (PTGS2)
Enzymes [BR:biu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     109570734 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF
Motif
Other DBs
NCBI-GeneID: 109570734
NCBI-ProteinID: XP_019832459
LinkDB All DBs
Position
16
AA seq 604 aa AA seqDB search
MLARALLLCAAVALSGAANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCTTPEFL
TRIKLLLKPTPNTVHYILTHFKGVWNIVNKISFLRNMIMRYVLTSRSHLIESPPTYNVHY
SYKSWEAFSNLSYYTRALPPVPDDCPTPMGVKGRKELPDSKEVVKKVLLRRKFIPDPQGT
NLMFAFFAQHFTHQFFKTDFERGPAFTKGKNHGVDLSHIYGESLERQHKLRLFKDGKMKY
QMINGEMYPPTVKDTQVEMIYPPHVPEHLKFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIAAEFNTLYHWHPLLPDVFQIDGQEYNYQQFIYNNSVLLEHGLTQFVESFTRQRAGRV
AGGRNLPVAVEKVSKASIDQSREMKYQSFNEYRKRFLLKPYESFEELTGEKEMAAELEAL
YGDIDAMEFYPALLVEKPRPDAIFGETMVEAGAPFSLKGLMGNPICSPEYWKPSTFGGEV
GFKIINTASIQSLICSNVKGCPFTSFSVQDTHLTKTVTINASSSHSGLDDINPTVLLKER
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcccgggccctgctgctctgcgctgccgtggcgctcagcggtgcagcaaatcct
tgctgttcccatccatgccagaatcgaggtgtatgtatgagtgtaggatttgaccagtat
aaatgtgactgtacccgaacaggattctacggtgaaaactgtaccacacccgaatttctg
acaagaataaaattactcctgaaacccactcccaacacagtgcactacatacttacccac
ttcaaaggagtctggaacattgtcaataagatctccttcctgcgaaatatgattatgaga
tatgtgttgacgtcgagatcacatttgattgagagtccaccaacttataatgtgcactac
agctataaaagctgggaagccttttctaacctgtcttattataccagagctcttcctcct
gtgcctgatgactgcccaacacccatgggtgtgaaagggaggaaagagcttcctgattca
aaagaagttgtgaaaaaagtacttctaagaagaaagttcattcctgatccccagggcaca
aatctgatgtttgcattctttgcccagcacttcacccatcaatttttcaagacagatttt
gaacgaggaccagctttcactaagggaaagaaccatggggtggacttaagtcacatttat
ggtgaatctttagagagacagcataagctgcgccttttcaaggatggaaaaatgaaatat
cagatgattaatggagagatgtatcctcccacagtcaaagatactcaggtcgaaatgatc
tacccgcctcatgttcctgaacacttgaagtttgctgtgggccaggaagtctttggtctg
gtgcctggtctgatgatgtatgccaccatttggctacgggaacacaacagagtgtgtgat
gtgcttaaacaagagcatccagaatggggcgatgagcagttgttccagacaagcaggcta
atcctgataggagaaactattaagattgtgattgaagactacgtacagcacttgagtggc
tatcacttcaaactgaagtttgacccagagctgcttttcaaccaacagttccagtaccag
aaccgtattgctgctgagtttaacacgctctaccactggcatccccttctgcctgacgtc
tttcagattgatggtcaggagtacaactatcagcagtttatctataacaactctgtctta
ctggaacatggtctcactcagtttgttgaatcattcaccaggcaaagggctggcagggtc
gctggcggtaggaatcttccagtcgcagtagagaaagtatcaaaggcttcaattgaccag
agcagagagatgaaataccagtcttttaatgagtatcgcaaacgttttctgctgaagccc
tatgaatcatttgaggaacttacaggagagaaggaaatggctgcagagttagaagcgctc
tatggagacatagatgccatggagttttatcccgcccttctggtagagaagccccgtcca
gaygccatctttggggagaccatggtagaagctggagcaccattctccctgaaaggactt
atgggtaatcctatatgctctcccgagtactggaagcctagcactttcggtggagaagta
ggttttaaaatcatcaacactgcctcaattcagtctctcatctgcagtaacgtgaaaggc
tgtccctttacctcattcagtgttcaagatacgcacctcaccaaaacggtcaccattaat
gcaagctcttcccactctggactagatgatatcaaccccacagtcctactaaaggaacgt
tcaaccgaactgtag

DBGET integrated database retrieval system