KEGG   Bos indicus (zebu cattle): 109570739
Entry
109570739         CDS       T04792                                 

Gene name
CACNA1E
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E isoform X1
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04020  Calcium signaling pathway
biu04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109570739 (CACNA1E)
   04020 Calcium signaling pathway
    109570739 (CACNA1E)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    109570739 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:biu04040]
    109570739 (CACNA1E)
Ion channels [BR:biu04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   109570739 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel DPBB_1
Other DBs
NCBI-GeneID: 109570739
NCBI-ProteinID: XP_019832465
LinkDB
Position
16
AA seq 2311 aa
MARFGEAVVGRPGSGDGDSDQSRNRQGTPVPASGXXXAYKQSKAQRARTMALYNPIPVRQ
NCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMILATIIANCIVLALEQHLPEDDKTPM
SRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNGWNVMDFIVVLSGILATAGTHF
NTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGL
EFYSGKLHRACFMNNSGILEGFDPPHPCGVQGCPAGYECRDWIGPNDGITQFDNILFAVL
TVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERER
VENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNAGTSALEVLRRATIKRSRT
EAMARDSSDEHCVDISSVGTPLARASIKSAKVDGASYFRHKERLLRISIRHMVKSQVFYW
IVLSLVALNTACVAIVHHNQPQWLTHLLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSSF
NCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSSM
KSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSANFDTFPAAIMTVFQILTGEDWN
EVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEE
EAFNQKHALQKAKEVSPMSAPNMPSIERDRRRRHHMSMWEPRSSHLRERRRRHHMSVWEQ
RTSQLRRHMQMSSQEALNKEEAPPMNPLNPLNPLSPLNPLSAHPSLYRRPRAIEGLALGL
GLEKCEEERVSRGGSLKGDGGDLASALDSQRSPLALGKREPPWLARPCHGNCDPTQPEAG
SGETVVTFGDRXRHRKSQRRSRHRRVRTEGREPSSTSRSRSASQERSLDEAVPSEGERDR
EPRAGHGGKEPMIQEEERERCQDLRRTNSLMVPRGSGLAGALDEADTPLVPPQPELEVGK
DAALTEQEPEGSSEQALLGDVKLDMGRVSQSEPDLSCVTANTDKATTESTSVTVTIPDVG
PLVDSTVVHISNKTDGEASPLKEAEIREDEEEVEKKQQKKEKRETGKAMVPHSSMFIFST
TNPIRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSERNKVLRYFDYVFTGVFT
FEMVIKMIDQGLILQDGSYFRDLWNILDFVVVVGALVAFALANALGTNKGRDIKTIKSLR
VLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYC
TDSSKDTEKECIGNYVDHEKNKMEVKGREWKRHEFHYDNIIWALLTLFTVSTGEGWPQVL
QHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECS
LEKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMMK
YYSAPCTYELALKYLNIAFTMVFSLECVLKIIAFGFLNYFRDTWNIFDFITVIGSITEII
LTDSKLVNTSGFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLF
FIYAIIGMQVFGNIKLDEESHINRHNNFRSFFGSLMLLFRSATGEAWQEIMLSCLGEKGC
EPDTTAPSGQSESERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGP
HHLDEFVRVWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRLVLMNMPVA
EDMTVHFTSTLMALIRTALDIKIAKGGADRQQLDSELQKETLAIWPHLSQKMLDLLVPMP
KASDLTVGKIYAAMMIMDYYKQSKVKKQRQQLEEQKNAPMFQRMEPSSLPQEIIANAKAL
PYLQQDPVPGLSGRSAYPSMSPLSPQEIFQLACMDPADDGQFQERQSLEPEVSELKSVQP
SNHGIYLPSDTQEHAGSGKASSMPRLTVDPQVVTDPSSMRRSFSTIRDKRSNSSWLEEFS
MERSSENTYKSRRRSYHSSLRLSAHRLNSDSGHKSDTHRSGGRERGRSKERKHLLSPDVS
RCNSEERGTQADWESPERHQSRSPSEGRSQTPNRQGTGSLSESSIPSVSDSSTPRRSRRQ
LPPVPPKPRPLLSYSSLIRHAGSISPPADGSEGGSPLTSQALESNNAGLPESSNPRQGHP
SPQRYISEPYLALHEDSHASDCGEEETLTFEAAVATSLGRSNTIGSAPPLRHSWQMPNGH
YRRRRRGGPGPGTTCGAVSDLLSDTEEDDKC
NT seq 6936 nt   +upstreamnt  +downstreamnt
atggctcgcttcggggaggcggtggtcggcaggccggggtcgggcgatggagactcggac
cagagcaggaaccggcaaggaacccccgtgccggcctccgggannnnnnccgcctacaag
cagtcgaaagcgcagagggcgcggactatggctttgtacaaccctattcccgtccggcag
aactgtttcaccgtcaacagatccctgttcatcttcggagaagataacattgtcaggaaa
tacgccaagaagctcatcgattggccgccgtttgagtacatgatcttggccaccatcatt
gccaattgcatcgtcttggccctggagcaacatcttcctgaggatgacaagaccccaatg
tcccgcagactggagaagacagaaccctatttcattgggatcttttgctttgaagctggg
atcaaaatcgtggccctggggttcatcttccataagggatcatacctccgcaatggttgg
aatgtcatggacttcatcgtggtcctcagtggcatcctggctactgcgggaacccacttc
aacacccatgtggacctgaggaccctccgggccgtgcgtgtcctgaggcccctgaagctc
gtgtcggggatacctagcctacagattgtgttgaaatccatcatgaaggccatggtgcct
ctcctgcagattggccttctgctcttctttgccatcctgatgtttgctatcatcggcttg
gagttctacagtggaaagttgcaccgagcgtgcttcatgaacaattcaggtattctagaa
ggatttgacccccctcacccatgtggcgtgcagggctgcccagctggttatgaatgccgg
gactggatcggccccaatgatgggatcacccagtttgataacatcctttttgccgtgctg
accgtcttccagtgtatcaccatggaagggtggaccaccgtgctgtacaataccaatgat
gccttaggagccacctggaattggctgtacttcatccccctcatcatcattggatccttc
tttgttctcaaccttgtcctgggagtgctttccggggaatttgccaaagagagagagaga
gtggagaaccggagagccttcatgaaactgcggcgccagcagcagatcgagcgtgagctt
aacgggtaccgcgcctggatagacaaagcagaggaagtcatgcttgctgaagaaaacaaa
aatgctggaacgtcagccttagaagtgcttcggagggcaaccatcaaaaggagccggacc
gaggccatggcacgggactccagcgatgagcactgcgtggacatctcctctgtgggcaca
cctctcgcccgagccagcatcaagagcgccaaggtggacggggcctcctatttccggcac
aaggagcgacttttgcggatctctatccgccacatggttaagtcccaggtcttctactgg
atcgtgctgagcctggtggctctcaacaccgcctgtgtggccattgtccaccacaaccag
ccccagtggctcacccaccttctctactatgcagagtttctgtttctggggctcttcctt
ctagagatgtccctgaagatgtacggcatggggcctcgcctttattttcactcttccttc
aactgctttgactttggggtcacagtgggcagcatctttgaagtagtctgggccatcttc
agacctggtacatctttcggaatcagtgtcctgcgagctctccggcttctaagaatattt
aaaataaccaagtattgggcatccctccggaatttggtggtctccttgatgagttccatg
aagtctatcatcagtttactcttcctccttttcctcttcattgttgtctttgctctgcta
ggaatgcaactgtttgggggcaggttcaactttaatgatgggactccttccgcaaacttt
gacaccttccctgcagccatcatgactgtattccagatcctgacgggtgaggactggaat
gaggtgatgtacaacgggatccgctcccagggtggggtcagctcgggcatgtggtctgcg
atctatttcattgtgctcaccttgtttggaaactacacactgctgaatgtgttcttggcc
atcgctgtggacaatctggccaatgcccaggagctgaccaaggatgaacaagaagaagag
gaggccttcaaccagaagcatgcactgcagaaggccaaggaggtcagcccgatgtctgca
cccaacatgccttccatcgaaagagacagaaggagaagacaccacatgtcgatgtgggag
ccacgcagcagccacctgagggagcggaggcgccggcatcacatgtccgtgtgggagcag
cgaaccagccagttgaggaggcacatgcagatgtccagccaggaggccctcaacaaggag
gaggccccgcccatgaaccccctcaaccccctcaacccgctgagccccctcaacccgctc
agcgcgcaccccagcctctaccggagaccccgggccatcgaggggctagccctgggcctg
gggctggagaagtgtgaggaagagcgcgtcagccgtggggggtccctcaaaggggatgga
ggggacttggcgagcgccctggacagccagaggagccccctggccctgggcaaacgggag
ccaccctggctggcccggccctgtcacgggaactgtgacccgacccagccggaggcgggc
agtggggagacggtggtgaccttcggggaccgggnccggcacaggaagagccagcggcgc
agccggcaccgccgcgtcaggaccgagggcagggagccctcctccacctccagaagcagg
tctgccagccaggagcggagtctggacgaagctgtgcccagcgagggggagagggaccgt
gagcccagggctggccatgggggcaaagaacccatgatccaggaggaagagcgagagcga
tgccaggacttacggaggaccaacagtctgatggtgcccagaggctccgggctggcagga
gccctggatgaggccgacacaccccttgtcccaccccagccggagctggaagtggggaag
gacgcagccctgacggagcaggagccggagggcagcagtgagcaggctctgctgggggac
gtgaagctggacatgggccgggtcagccagagcgagcccgacctctcctgcgtcacggcc
aacacggacaaggccaccaccgagagcaccagcgtcactgtcaccatccccgacgtgggc
cccttggtggactcaaccgtggtgcacatcagcaacaagactgatggagaagccagtccc
ttgaaagaggcagagatcagagaggatgaggaggaggtggagaagaagcagcagaagaag
gagaagcgtgagacgggcaaggccatggtgccccacagctcgatgttcatcttcagcacc
accaacccgatccgcagggcctgccactacatcgtgaacctgcgctacttcgagatgtgc
atcctcctggtgatcgcagccagcagcatcgccctggcggccgaggaccccgtcctgacc
aactcagagcgcaacaaagtgctgaggtattttgactatgtgttcactggcgtgttcacc
tttgagatggttataaagatgatagaccagggcttgattctgcaggacggctcctacttc
cgagacctgtggaacatcctggacttcgtggtggtggttggcgcattggtggcctttgct
ctggcgaatgctttgggaactaacaagggccgggatattaagaccatcaagtccctgagg
gttctccgtgtcctgaggccgctgaagaccatcaagcgcctgcccaagctcaaggctgtc
tttgactgtgtggtcacctccttgaaaaacgtcttcaacatactcattgtctacaagctc
ttcatgttcatctttgctgtcatcgcagttcagcttttcaagggcaagttcttctactgc
acggacagttccaaggacacagagaaggagtgcataggcaactatgtagatcacgagaaa
aacaagatggaggtgaaaggccgagagtggaagcgccatgaattccattatgacaacatc
atctgggctctgctgaccctcttcactgtctccacaggggaagggtggcctcaggtcttg
cagcactcggtcgatgtgacagaggaagaccgaggcccaagccgcagcaaccggatggag
atgtccatcttttatgtggtctactttgtggtcttccccttcttctttgtcaacatcttt
gtggctctcatcatcatcaccttccaggagcaaggggacaagatgatggaagagtgcagc
ctggagaagaatgagagggcatgcatcgacttcgccatcagcgccaaaccgctcacccgc
tacatgccccagaacaggcacaccttccagtaccgcgtctggcacttcgtggtgtctcca
tcctttgagtacaccatcatggccatgatcgccctgaacaccgtcgtgctgatgatgaag
tactactctgctccctgtacctatgagctggccctgaagtacctaaatatcgccttcacc
atggtgttttccctggaatgtgtcctgaagatcattgcatttggcttcttgaactatttc
cgagacacctggaatatctttgacttcatcactgtgattggcagtatcacagaaattatt
ctgacggacagcaagctggtgaacactagtggcttcaacatgagctttctgaagctcttc
cgagcggcccgcctcatcaagctgctgcgtcagggctacaccatccgcattttactgtgg
accttcgtgcagtcctttaaggcccttccctatgtctgccttctgatcgccatgcttttc
ttcatctatgccatcattgggatgcaggtctttggaaacataaagttagatgaggagagt
cacatcaaccggcacaacaacttccggagtttctttgggtccctcatgctgctcttcagg
agtgccacgggtgaggcctggcaggagataatgctgtcgtgtctcggggagaagggctgt
gagcccgacaccactgcgccgtcggggcagagcgagagcgagcgctgtggcaccgacctg
gcctacgtgtacttcgtctccttcatcttcttctgctccttcctgatgctcaacctgttc
gtggccgtcatcatggacaactttgagtacctgactcgggactcgtccatcctggggcct
caccatctggacgagtttgtccgagtctgggcagagtatgacagagcagcatgtggccgc
atccattacactgagatgtatgaaatgctgactctcatgtcaccgccgctaggcctcggc
aagagatgtccctccaaggtggcatataagaggttggtcttgatgaacatgccagtggcc
gaggacatgaccgtccacttcacttccacgctgatggctctaatccggacagctctggac
attaaaatcgccaaaggcggtgcagacaggcagcagctagactcagagctccagaaggag
accctggccatctggcctcacctgtcccagaagatgctggatctgctcgtgcccatgccc
aaagcctctgacctgactgtgggcaaaatctatgcagcaatgatgatcatggactactac
aaacagagcaaggtgaagaagcagaggcagcagctggaggaacagaaaaacgcacccatg
ttccagcgcatggagccctcgtctctgcctcaggagatcatcgctaatgccaaagccctg
ccttatctccagcaggaccccgttccaggcctgagtggccggagtgcatacccttcgatg
agtccactctccccgcaggaaatattccagttggcctgtatggacccagctgatgatgga
cagttccaggaacgacaatctctggagccagaggttagtgaattaaaaagcgtgcagccc
tctaaccatggcatctaccttccttcggacacccaggagcatgcgggctctgggaaggca
tcctctatgccacgcctgactgtggatccccaggtggtgacagaccccagctccatgaga
cgttcattttccaccattcgcgataagcgttcaaattcctcgtggctggaggaattctcc
atggagcgaagcagcgaaaacacctacaagtcccggcgccggagttaccactcctccctg
aggctgtcagcccaccgtctgaactcggactcaggccacaagtccgacacccaccgctca
gggggcagagagcggggacgatcgaaagagcgaaagcatcttctctctcctgacgtctcc
cgctgcaactccgaggagcgagggacccaggccgactgggagtccccagagcgccatcag
tcccggtctcccagtgaaggcaggtcacagacccccaacagacagggcacggggtccctg
agtgagagctccatcccctctgtctccgactccagcaccccacgacgaagtcggcggcag
ctccccccagtccctcccaagcctcggcccctcctttcctacagctctctgatcagacac
gctgggagcatctccccaccagctgatgggagcgagggtggctccccactgacctcccaa
gctctggagagcaacaacgccggcctgcccgagtcttccaacccccggcagggccacccc
tccccacagcgctacatctccgagccctacctggccctgcacgaagactcccacgcctcg
gactgcggcgaggaggagacgctcacctttgaagcagccgtggccaccagcctgggccgg
tccaacaccatcggctcggccccgcccctgcggcacagctggcagatgcccaatgggcac
tatcggcggcggaggcgcggggggcctggaccgggcacgacgtgcggagctgtcagcgac
ctcctgagtgacacggaagaagacgacaaatgctag

DBGET integrated database retrieval system