KEGG   Bos indicus (zebu cattle): 109570838
Entry
109570838         CDS       T04792                                 

Gene name
OSM
Definition
(RefSeq) oncostatin-M
  KO
K05418  oncostatin M
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109570838 (OSM)
   04151 PI3K-Akt signaling pathway
    109570838 (OSM)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109570838 (OSM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109570838 (OSM)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  CSF and other factors
   109570838 (OSM)
SSDB
Motif
Pfam: LIF_OSM
Other DBs
NCBI-GeneID: 109570838
NCBI-ProteinID: XP_019832551
UniProt: A0A6P5D2R9
LinkDB
Position
17
AA seq 237 aa
MRAQRMQRTLLSLVLRLLLLCSVATGKCSGKYHELLLQLQRQADLMQDPSTLLDPYIRLQ
GLHSPXLQEHCRERPGDFPSEDALWRLSRQDFLQTLNTTLGLILRMLSALQQDLPEAAHQ
QAEMNVRGFGNNIHCMAQLLRGSSDPKAAEPTQPGPGPTPLPPTPPSSTFQRKLRNCGFL
RGYHRFMRTAGQVLRGWGERQGRSRRHSPCRALKRGARRTRPFPEIRRLAPRGQPPR
NT seq 714 nt   +upstreamnt  +downstreamnt
atgcgggcacagcgtatgcagagaacactgctcagtctggtcctcagacttctgctcctg
tgctcagtggccacgggcaagtgctcgggcaagtaccacgagcttctcctgcarctycag
cgccaggcggacctcatgcaggaccccagcacgctcctggatccctacatccgcctccaa
ggcctacacagtcccrtactgcaggaacactgcagggagcgcccgggggactttcccagc
gaggatgccctgtggaggctcagcaggcaggacttcctgcagaccctcaacaccacactg
ggcctcatccttcgcatgctgagtgccctgcagcaggacctcccggaagcagcccaccaa
caggcggagatgaatgtccgcgggttcgggaacaacatccactgcatggcccagctgctg
cgtggctcctcggacccaaaggctgctgagcccacccagccgggcccagggcccaccccg
ctgccacccacgccgccttccagyaccttccagcgcaagctcaggaactgtgggttcctg
cgaggctaccaccgcttcatgcgcacagccgggcaggtcctccggggctggggggagaga
cagggccgcagccgcagacacagcccctgccgggccctgaagaggggggcccgcaggaca
cggcccttcccggagatcaggagactcgcgcccaggggccagccgccccggtag

DBGET integrated database retrieval system