KEGG   Bos indicus (zebu cattle): 109570862
Entry
109570862         CDS       T04792                                 

Gene name
HHIP
Definition
(RefSeq) hedgehog-interacting protein
  KO
K06231  hedgehog interacting protein
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04024  cAMP signaling pathway
biu04340  Hedgehog signaling pathway
biu05200  Pathways in cancer
biu05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    109570862 (HHIP)
   04024 cAMP signaling pathway
    109570862 (HHIP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109570862 (HHIP)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    109570862 (HHIP)
SSDB
Motif
Pfam: GSDH Folate_rec EGF_2
Other DBs
NCBI-GeneID: 109570862
NCBI-ProteinID: XP_019832563
UniProt: A0A6P5D374
LinkDB
Position
17
AA seq 643 aa
MNFSLSMRRSPPPKKNITKPNFVELNRSLFLISGFQIFSVTNNTECGKLLEEIKCAVCSP
HSQSLFYSPEREALERDLVLPLLCKDYCTEFFYTCRGHIPGLLQTTADEFCFYYARKDGG
LCFPDFPRKQIRGPASNYLDQMEEYDKVEEISRKHKHNCFCIQEVVSGLRQPVSALQSGD
GSHRLFILEKEGYVKILTPEGEIFKEPYLDIHKLVQSGIKGGDERGLLSLAFHPNYKKNG
KLYVSYTTNQERWAMGPHDHILRVVEYTVSRKNPHQVDLRTARVFLEVAELHRKHLGGQL
LFGPDGFLYIILGDGMITLDDMEEMDGLSDFTGSVLRLDVDTDMCHAPYSIPRSNPHFNS
TNQPPEVFAHGLHDPGRCAVDRHPTDININLTILCSDSNGKNSSSARILQIIKGKDYESE
PSLLEFKPFSNGPLVGGFVYRGCQSERLYGSYVFGDRNGNFLTLQQSPVSKQWQEKPLCL
GNGGSCRGYFSGHILGFGEDELGEVYILSSSKSMTQTHNGKLYKIIDPKRPLMPEECRAV
VQPAQTLTSECSRLCRNGYCTPTGTCCCSPGWEGDFCRIAKCEPACCHGGVCVRPNKCLC
KKGYLGAQCEQVDRNLRRVTRAGILDQIIDMTSYLLDLTSYIV
NT seq 1932 nt   +upstreamnt  +downstreamnt
atgaacttttctctttctatgagacgctccccgccccccaaaaaaaacataactaaacct
aacttcgtagaactaaacagaagtctttttctaatttctggctttcagatattttctgtt
accaacaacacagaatgcgggaagttactggaggaaatcaagtgtgccgtttgctctcca
cattctcagagcctgttctactcacctgagagagaagccttggaaagagatctggtactt
cccttgctctgcaaagactattgcacagaattcttttatacttgccgaggccatattcca
ggtttacttcaaactactgctgatgagttttgcttttactatgcaagaaaagatggtggc
ctgtgctttcctgattttccaagaaaacaaatcagaggaccagcctctaactacttggac
cagatggaagaatatgacaaagtggaagagatcagcagaaagcacaaacacaactgcttc
tgtatccaggaggttgtgagtgggctgcgccagcctgtcagcgcccttcagagtggggat
ggctcccaccgcctcttcattctggaaaaagaaggttacgtgaagatacttacccccgaa
ggagaaattttcaaggagccttatttggacattcacaaacttgttcagagtggaataaag
ggaggagatgaaagaggactgctaagccttgcattccatcccaattacaagaaaaatgga
aagctatacgtgtcttataccaccaaccaagaacggtgggctatggggcctcatgatcat
attcttagagttgtggaatacacagtatccaggaaaaacccccatcaagttgatctacga
acagccagagtatttcttgaagtcgccgaactccacagaaagcacctagggggacagctg
ctcttcggtcctgacggctttctgtacatcatcctcggtgacgggatgatcacactggat
gatatggaagaaatggatggattaagcgacttcacaggttccgtgctccggctggacgtg
gatactgacatgtgccacgcgccgtactccatacctaggagcaacccgcacttcaacagc
accaaccagcccccagaagtgtttgcccatggcctccatgatccaggcagatgcgctgtg
gatcgacaccccactgatataaacatcaatttaacaatactttgttcagactccaatgga
aagaacagctcatcggccagaatcctacagatcataaaggggaaagactatgaaagtgag
ccatcacttttagaattcaagccattcagtaatggtcctttggttggtggatttgtttac
cgaggctgccagtcagaaagactctacggaagctacgtgtttggagatcgtaatgggaat
ttcttaaccctccagcaaagtcctgtgagcaagcaatggcaagaaaaaccactctgtctt
ggcaacggtggttcctgtagaggttacttttcaggtcacattttgggatttggagaagac
gaattaggtgaagtttacattctatcaagtagtaaaagtatgacccagactcacaatgga
aaactctataaaattattgatcccaaaagacctctgatgcctgaggaatgcagggctgtg
gtccagcccgcccagaccctaacatccgagtgctcccggctctgtcggaatggctactgc
acccctacgggaacgtgctgctgcagtcccggctgggaaggggacttctgcagaatcgcg
aaatgtgagccagcgtgttgccacggtggtgtctgtgttagacccaacaagtgcctctgt
aaaaaaggatatcttggtgctcagtgtgaacaagtggacagaaacctccgcagagtgacc
agggcaggtattcttgatcagatcattgacatgacatcttatttgctggatctaacaagt
tacattgtatag

DBGET integrated database retrieval system