Bos indicus (zebu cattle): 109570973 Help Entry 109570973         CDS       T04792                                  Gene name MAPK1 Definition (RefSeq) mitogen-activated protein kinase 1   KO K04371   mitogen-activated protein kinase 1/3 [EC:2.7.11.24] Organism biu  Bos indicus (zebu cattle) Pathway biu01521   EGFR tyrosine kinase inhibitor resistance biu01522   Endocrine resistance biu01524   Platinum drug resistance biu04010   MAPK signaling pathway biu04012   ErbB signaling pathway biu04014   Ras signaling pathway biu04015   Rap1 signaling pathway biu04022   cGMP-PKG signaling pathway biu04024   cAMP signaling pathway biu04062   Chemokine signaling pathway biu04066   HIF-1 signaling pathway biu04068   FoxO signaling pathway biu04071   Sphingolipid signaling pathway biu04072   Phospholipase D signaling pathway biu04114   Oocyte meiosis biu04140   Autophagy - animal biu04150   mTOR signaling pathway biu04151   PI3K-Akt signaling pathway biu04210   Apoptosis biu04218   Cellular senescence biu04261   Adrenergic signaling in cardiomyocytes biu04270   Vascular smooth muscle contraction biu04350   TGF-beta signaling pathway biu04360   Axon guidance biu04370   VEGF signaling pathway biu04371   Apelin signaling pathway biu04380   Osteoclast differentiation biu04510   Focal adhesion biu04520   Adherens junction biu04540   Gap junction biu04550   Signaling pathways regulating pluripotency of stem cells biu04611   Platelet activation biu04613   Neutrophil extracellular trap formation biu04620   Toll-like receptor signaling pathway biu04621   NOD-like receptor signaling pathway biu04625   C-type lectin receptor signaling pathway biu04650   Natural killer cell mediated cytotoxicity biu04657   IL-17 signaling pathway biu04658   Th1 and Th2 cell differentiation biu04659   Th17 cell differentiation biu04660   T cell receptor signaling pathway biu04662   B cell receptor signaling pathway biu04664   Fc epsilon RI signaling pathway biu04666   Fc gamma R-mediated phagocytosis biu04668   TNF signaling pathway biu04713   Circadian entrainment biu04720   Long-term potentiation biu04722   Neurotrophin signaling pathway biu04723   Retrograde endocannabinoid signaling biu04724   Glutamatergic synapse biu04725   Cholinergic synapse biu04726   Serotonergic synapse biu04730   Long-term depression biu04810   Regulation of actin cytoskeleton biu04910   Insulin signaling pathway biu04912   GnRH signaling pathway biu04914   Progesterone-mediated oocyte maturation biu04915   Estrogen signaling pathway biu04916   Melanogenesis biu04917   Prolactin signaling pathway biu04919   Thyroid hormone signaling pathway biu04921   Oxytocin signaling pathway biu04926   Relaxin signaling pathway biu04928   Parathyroid hormone synthesis, secretion and action biu04929   GnRH secretion biu04930   Type II diabetes mellitus biu04933   AGE-RAGE signaling pathway in diabetic complications biu04934   Cushing syndrome biu04935   Growth hormone synthesis, secretion and action biu04960   Aldosterone-regulated sodium reabsorption biu05010   Alzheimer disease biu05020   Prion disease biu05022   Pathways of neurodegeneration - multiple diseases biu05034   Alcoholism biu05132   Salmonella infection biu05133   Pertussis biu05135   Yersinia infection biu05140   Leishmaniasis biu05142   Chagas disease biu05145   Toxoplasmosis biu05152   Tuberculosis biu05160   Hepatitis C biu05161   Hepatitis B biu05163   Human cytomegalovirus infection biu05164   Influenza A biu05165   Human papillomavirus infection biu05166   Human T-cell leukemia virus 1 infection biu05167   Kaposi sarcoma-associated herpesvirus infection biu05170   Human immunodeficiency virus 1 infection biu05171   Coronavirus disease - COVID-19 biu05200   Pathways in cancer biu05203   Viral carcinogenesis biu05205   Proteoglycans in cancer biu05206   MicroRNAs in cancer biu05210   Colorectal cancer biu05211   Renal cell carcinoma biu05212   Pancreatic cancer biu05213   Endometrial cancer biu05214   Glioma biu05215   Prostate cancer biu05216   Thyroid cancer biu05218   Melanoma biu05219   Bladder cancer biu05220   Chronic myeloid leukemia biu05221   Acute myeloid leukemia biu05223   Non-small cell lung cancer biu05224   Breast cancer biu05225   Hepatocellular carcinoma biu05226   Gastric cancer biu05230   Central carbon metabolism in cancer biu05231   Choline metabolism in cancer biu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109570973 (MAPK1)    04012 ErbB signaling pathway     109570973 (MAPK1)    04014 Ras signaling pathway     109570973 (MAPK1)    04015 Rap1 signaling pathway     109570973 (MAPK1)    04350 TGF-beta signaling pathway     109570973 (MAPK1)    04370 VEGF signaling pathway     109570973 (MAPK1)    04371 Apelin signaling pathway     109570973 (MAPK1)    04668 TNF signaling pathway     109570973 (MAPK1)    04066 HIF-1 signaling pathway     109570973 (MAPK1)    04068 FoxO signaling pathway     109570973 (MAPK1)    04072 Phospholipase D signaling pathway     109570973 (MAPK1)    04071 Sphingolipid signaling pathway     109570973 (MAPK1)    04024 cAMP signaling pathway     109570973 (MAPK1)    04022 cGMP-PKG signaling pathway     109570973 (MAPK1)    04151 PI3K-Akt signaling pathway     109570973 (MAPK1)    04150 mTOR signaling pathway     109570973 (MAPK1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     109570973 (MAPK1)   09143 Cell growth and death    04114 Oocyte meiosis     109570973 (MAPK1)    04210 Apoptosis     109570973 (MAPK1)    04218 Cellular senescence     109570973 (MAPK1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     109570973 (MAPK1)    04520 Adherens junction     109570973 (MAPK1)    04540 Gap junction     109570973 (MAPK1)    04550 Signaling pathways regulating pluripotency of stem cells     109570973 (MAPK1)   09142 Cell motility    04810 Regulation of actin cytoskeleton     109570973 (MAPK1)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     109570973 (MAPK1)    04613 Neutrophil extracellular trap formation     109570973 (MAPK1)    04620 Toll-like receptor signaling pathway     109570973 (MAPK1)    04621 NOD-like receptor signaling pathway     109570973 (MAPK1)    04625 C-type lectin receptor signaling pathway     109570973 (MAPK1)    04650 Natural killer cell mediated cytotoxicity     109570973 (MAPK1)    04660 T cell receptor signaling pathway     109570973 (MAPK1)    04658 Th1 and Th2 cell differentiation     109570973 (MAPK1)    04659 Th17 cell differentiation     109570973 (MAPK1)    04657 IL-17 signaling pathway     109570973 (MAPK1)    04662 B cell receptor signaling pathway     109570973 (MAPK1)    04664 Fc epsilon RI signaling pathway     109570973 (MAPK1)    04666 Fc gamma R-mediated phagocytosis     109570973 (MAPK1)    04062 Chemokine signaling pathway     109570973 (MAPK1)   09152 Endocrine system    04910 Insulin signaling pathway     109570973 (MAPK1)    04929 GnRH secretion     109570973 (MAPK1)    04912 GnRH signaling pathway     109570973 (MAPK1)    04915 Estrogen signaling pathway     109570973 (MAPK1)    04914 Progesterone-mediated oocyte maturation     109570973 (MAPK1)    04917 Prolactin signaling pathway     109570973 (MAPK1)    04921 Oxytocin signaling pathway     109570973 (MAPK1)    04926 Relaxin signaling pathway     109570973 (MAPK1)    04935 Growth hormone synthesis, secretion and action     109570973 (MAPK1)    04919 Thyroid hormone signaling pathway     109570973 (MAPK1)    04928 Parathyroid hormone synthesis, secretion and action     109570973 (MAPK1)    04916 Melanogenesis     109570973 (MAPK1)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     109570973 (MAPK1)    04270 Vascular smooth muscle contraction     109570973 (MAPK1)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     109570973 (MAPK1)   09156 Nervous system    04724 Glutamatergic synapse     109570973 (MAPK1)    04725 Cholinergic synapse     109570973 (MAPK1)    04726 Serotonergic synapse     109570973 (MAPK1)    04720 Long-term potentiation     109570973 (MAPK1)    04730 Long-term depression     109570973 (MAPK1)    04723 Retrograde endocannabinoid signaling     109570973 (MAPK1)    04722 Neurotrophin signaling pathway     109570973 (MAPK1)   09158 Development and regeneration    04360 Axon guidance     109570973 (MAPK1)    04380 Osteoclast differentiation     109570973 (MAPK1)   09159 Environmental adaptation    04713 Circadian entrainment     109570973 (MAPK1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109570973 (MAPK1)    05206 MicroRNAs in cancer     109570973 (MAPK1)    05205 Proteoglycans in cancer     109570973 (MAPK1)    05203 Viral carcinogenesis     109570973 (MAPK1)    05230 Central carbon metabolism in cancer     109570973 (MAPK1)    05231 Choline metabolism in cancer     109570973 (MAPK1)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     109570973 (MAPK1)   09162 Cancer: specific types    05210 Colorectal cancer     109570973 (MAPK1)    05212 Pancreatic cancer     109570973 (MAPK1)    05225 Hepatocellular carcinoma     109570973 (MAPK1)    05226 Gastric cancer     109570973 (MAPK1)    05214 Glioma     109570973 (MAPK1)    05216 Thyroid cancer     109570973 (MAPK1)    05221 Acute myeloid leukemia     109570973 (MAPK1)    05220 Chronic myeloid leukemia     109570973 (MAPK1)    05218 Melanoma     109570973 (MAPK1)    05211 Renal cell carcinoma     109570973 (MAPK1)    05219 Bladder cancer     109570973 (MAPK1)    05215 Prostate cancer     109570973 (MAPK1)    05213 Endometrial cancer     109570973 (MAPK1)    05224 Breast cancer     109570973 (MAPK1)    05223 Non-small cell lung cancer     109570973 (MAPK1)   09164 Neurodegenerative disease    05010 Alzheimer disease     109570973 (MAPK1)    05020 Prion disease     109570973 (MAPK1)    05022 Pathways of neurodegeneration - multiple diseases     109570973 (MAPK1)   09165 Substance dependence    05034 Alcoholism     109570973 (MAPK1)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     109570973 (MAPK1)    04933 AGE-RAGE signaling pathway in diabetic complications     109570973 (MAPK1)    04934 Cushing syndrome     109570973 (MAPK1)   09171 Infectious disease: bacterial    05132 Salmonella infection     109570973 (MAPK1)    05135 Yersinia infection     109570973 (MAPK1)    05133 Pertussis     109570973 (MAPK1)    05152 Tuberculosis     109570973 (MAPK1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     109570973 (MAPK1)    05170 Human immunodeficiency virus 1 infection     109570973 (MAPK1)    05161 Hepatitis B     109570973 (MAPK1)    05160 Hepatitis C     109570973 (MAPK1)    05171 Coronavirus disease - COVID-19     109570973 (MAPK1)    05164 Influenza A     109570973 (MAPK1)    05163 Human cytomegalovirus infection     109570973 (MAPK1)    05167 Kaposi sarcoma-associated herpesvirus infection     109570973 (MAPK1)    05165 Human papillomavirus infection     109570973 (MAPK1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     109570973 (MAPK1)    05140 Leishmaniasis     109570973 (MAPK1)    05142 Chagas disease     109570973 (MAPK1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     109570973 (MAPK1)    01524 Platinum drug resistance     109570973 (MAPK1)    01522 Endocrine resistance     109570973 (MAPK1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:biu01001]     109570973 (MAPK1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:biu03036]     109570973 (MAPK1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:biu04147]     109570973 (MAPK1) Enzymes [BR:biu01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      109570973 (MAPK1) Protein kinases [BR:biu01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    109570973 (MAPK1) Chromosome and associated proteins [BR:biu03036]  Eukaryotic type   Centromeric chromatin formation proteins    SAC (spindle assembly checkpoint) factors     Protein kinases      109570973 (MAPK1) Exosome [BR:biu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109570973 (MAPK1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Choline_kinase Motif Other DBs NCBI-GeneID:  109570973 NCBI-ProteinID:  XP_019832660 UniProt:  A0A6P5D483 LinkDB All DBs Position 17 AA seq 552 aa AA seqDB search MIVLNPAWXAGRVCVCAERGQAVPLALGPELRVTLGLVYVALYVCASGPPSPGSSQLPSA GRWAVFRICVYFKGHCLNVEERSLSPFRPVAAPLQSDCPSRVPICASEXVTSRSLPXRSQ CCAPTPCRGLLRPALVANTPEGVHSLLQGTLGVLKSLTWFFNQKSVKRAPRGAWRRVHHC CCVGFCRARPSGHLGKNWAPCQDCESSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKI LLRFRHENIIGINDIIRAPTIEQMKDVYPFQAAAPSPAGVRHLDAPCLWGGRSAACGRGR CALLASHCGTCINCNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDF GLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIF PGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALD LLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPVAEAPFKFDMELDDLPKEKLKELIF EETARFQPGYRS NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt atgatcgtgctgaatcctgcatggcyggcggggcgggtgtgcgtctgcgccgagcggggt caggcggtgccgctggcccttggccctgagctgcgcgtcacactgggrctggtttatgtc gccctgtacgtttgcgcctcggggccgccatcacctggttcctcccagctgccctccgcc ggccgctgggctgttttccgtatctgtgtctattttaaaggccactgcctcaatgtggaa gagcgttcgctgagcccctttcgccctgtagctgccccgctgcagagcgactgtccctcc cgtgtccccatctgtgcttcggagygcgtcactagccgcagcctgcccayccgcagccag tgctgtgcgcccaccccctgccgtgggctgctgcggcccgcccttgtggcgaacacccca gagggcgtccactcgctgcttcaggggaccctgggggttttgaaaagtctcacatggttc ttcaatcaaaagagtgtgaagcgcgcgccgcgaggggcttggcggcgtgttcatcactgc tgctgcgtggggttctgtcgagccagaccttcaggacaccttgggaagaactgggcccca tgtcaggactgtgagagctctgcttatgacaatgtcaacaaagtccgagtcgccatcaag aaaatcagcccttttgagcaccagacgtactgccagagaacgctgagagagataaagatc ttactgcgcttcagacatgagaacatcatcggaatcaatgacattattcgagcaccgacc atcgagcagatgaaagatgtgtatcctttccaggcagctgctccgtcacctgctggagtc aggcacctggacgcgccctgcttgtggggagggaggagcgctgcctgtggacggggacgc tgtgctctgctcgccagtcactgtggcacttgcatcaactgcaacgaccacatctgctat tttctctaccagatcctcagagggttaaagtatattcattcagccaacgtgctgcaccgt gacctcaaaccttccaacctgctgctcaacaccacctgcgatctcaagatctgtgacttt ggcttggcccgtgttgcagatccagaccacgaccacacagggttcttgacagagtacgtg gccactcgctggtaccgggctccagaaatcatgttgaattccaagggctacaccaagtcc atcgacatctggtccgtcggctgcatcctcgcggagatgctctccaacaggcccatcttc cccgggaagcactaccttgaccagctgaaccacattctgggtattcttggatccccgtcg caggaagacctgaattgtataataaatttaaaagctagaaactacctgctctctcttcca cacaaaaataaggtgccatggaacaggctgttcccgaacgcggactccaaagctctggat ctactggacaaaatgttgacgttcaaccctcacaagaggatcgaggtggagcaggctctg gcccatccttacctggagcagtactacgacccgagcgatgagcccgtcgccgaagcaccc ttcaagtttgacatggaattggatgacttgcccaaggaaaagctcaaagaactcattttt gaagagactgctagattccagccgggataccgatcttaa

Bos indicus (zebu cattle): 109578667 Help Entry 109578667         CDS       T04792                                  Gene name MAPK3 Definition (RefSeq) mitogen-activated protein kinase 3   KO K04371   mitogen-activated protein kinase 1/3 [EC:2.7.11.24] Organism biu  Bos indicus (zebu cattle) Pathway biu01521   EGFR tyrosine kinase inhibitor resistance biu01522   Endocrine resistance biu01524   Platinum drug resistance biu04010   MAPK signaling pathway biu04012   ErbB signaling pathway biu04014   Ras signaling pathway biu04015   Rap1 signaling pathway biu04022   cGMP-PKG signaling pathway biu04024   cAMP signaling pathway biu04062   Chemokine signaling pathway biu04066   HIF-1 signaling pathway biu04068   FoxO signaling pathway biu04071   Sphingolipid signaling pathway biu04072   Phospholipase D signaling pathway biu04114   Oocyte meiosis biu04140   Autophagy - animal biu04150   mTOR signaling pathway biu04151   PI3K-Akt signaling pathway biu04210   Apoptosis biu04218   Cellular senescence biu04261   Adrenergic signaling in cardiomyocytes biu04270   Vascular smooth muscle contraction biu04350   TGF-beta signaling pathway biu04360   Axon guidance biu04370   VEGF signaling pathway biu04371   Apelin signaling pathway biu04380   Osteoclast differentiation biu04510   Focal adhesion biu04520   Adherens junction biu04540   Gap junction biu04550   Signaling pathways regulating pluripotency of stem cells biu04611   Platelet activation biu04613   Neutrophil extracellular trap formation biu04620   Toll-like receptor signaling pathway biu04621   NOD-like receptor signaling pathway biu04625   C-type lectin receptor signaling pathway biu04650   Natural killer cell mediated cytotoxicity biu04657   IL-17 signaling pathway biu04658   Th1 and Th2 cell differentiation biu04659   Th17 cell differentiation biu04660   T cell receptor signaling pathway biu04662   B cell receptor signaling pathway biu04664   Fc epsilon RI signaling pathway biu04666   Fc gamma R-mediated phagocytosis biu04668   TNF signaling pathway biu04713   Circadian entrainment biu04720   Long-term potentiation biu04722   Neurotrophin signaling pathway biu04723   Retrograde endocannabinoid signaling biu04724   Glutamatergic synapse biu04725   Cholinergic synapse biu04726   Serotonergic synapse biu04730   Long-term depression biu04810   Regulation of actin cytoskeleton biu04910   Insulin signaling pathway biu04912   GnRH signaling pathway biu04914   Progesterone-mediated oocyte maturation biu04915   Estrogen signaling pathway biu04916   Melanogenesis biu04917   Prolactin signaling pathway biu04919   Thyroid hormone signaling pathway biu04921   Oxytocin signaling pathway biu04926   Relaxin signaling pathway biu04928   Parathyroid hormone synthesis, secretion and action biu04929   GnRH secretion biu04930   Type II diabetes mellitus biu04933   AGE-RAGE signaling pathway in diabetic complications biu04934   Cushing syndrome biu04935   Growth hormone synthesis, secretion and action biu04960   Aldosterone-regulated sodium reabsorption biu05010   Alzheimer disease biu05020   Prion disease biu05022   Pathways of neurodegeneration - multiple diseases biu05034   Alcoholism biu05132   Salmonella infection biu05133   Pertussis biu05135   Yersinia infection biu05140   Leishmaniasis biu05142   Chagas disease biu05145   Toxoplasmosis biu05152   Tuberculosis biu05160   Hepatitis C biu05161   Hepatitis B biu05163   Human cytomegalovirus infection biu05164   Influenza A biu05165   Human papillomavirus infection biu05166   Human T-cell leukemia virus 1 infection biu05167   Kaposi sarcoma-associated herpesvirus infection biu05170   Human immunodeficiency virus 1 infection biu05171   Coronavirus disease - COVID-19 biu05200   Pathways in cancer biu05203   Viral carcinogenesis biu05205   Proteoglycans in cancer biu05206   MicroRNAs in cancer biu05210   Colorectal cancer biu05211   Renal cell carcinoma biu05212   Pancreatic cancer biu05213   Endometrial cancer biu05214   Glioma biu05215   Prostate cancer biu05216   Thyroid cancer biu05218   Melanoma biu05219   Bladder cancer biu05220   Chronic myeloid leukemia biu05221   Acute myeloid leukemia biu05223   Non-small cell lung cancer biu05224   Breast cancer biu05225   Hepatocellular carcinoma biu05226   Gastric cancer biu05230   Central carbon metabolism in cancer biu05231   Choline metabolism in cancer biu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109578667 (MAPK3)    04012 ErbB signaling pathway     109578667 (MAPK3)    04014 Ras signaling pathway     109578667 (MAPK3)    04015 Rap1 signaling pathway     109578667 (MAPK3)    04350 TGF-beta signaling pathway     109578667 (MAPK3)    04370 VEGF signaling pathway     109578667 (MAPK3)    04371 Apelin signaling pathway     109578667 (MAPK3)    04668 TNF signaling pathway     109578667 (MAPK3)    04066 HIF-1 signaling pathway     109578667 (MAPK3)    04068 FoxO signaling pathway     109578667 (MAPK3)    04072 Phospholipase D signaling pathway     109578667 (MAPK3)    04071 Sphingolipid signaling pathway     109578667 (MAPK3)    04024 cAMP signaling pathway     109578667 (MAPK3)    04022 cGMP-PKG signaling pathway     109578667 (MAPK3)    04151 PI3K-Akt signaling pathway     109578667 (MAPK3)    04150 mTOR signaling pathway     109578667 (MAPK3)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     109578667 (MAPK3)   09143 Cell growth and death    04114 Oocyte meiosis     109578667 (MAPK3)    04210 Apoptosis     109578667 (MAPK3)    04218 Cellular senescence     109578667 (MAPK3)   09144 Cellular community - eukaryotes    04510 Focal adhesion     109578667 (MAPK3)    04520 Adherens junction     109578667 (MAPK3)    04540 Gap junction     109578667 (MAPK3)    04550 Signaling pathways regulating pluripotency of stem cells     109578667 (MAPK3)   09142 Cell motility    04810 Regulation of actin cytoskeleton     109578667 (MAPK3)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     109578667 (MAPK3)    04613 Neutrophil extracellular trap formation     109578667 (MAPK3)    04620 Toll-like receptor signaling pathway     109578667 (MAPK3)    04621 NOD-like receptor signaling pathway     109578667 (MAPK3)    04625 C-type lectin receptor signaling pathway     109578667 (MAPK3)    04650 Natural killer cell mediated cytotoxicity     109578667 (MAPK3)    04660 T cell receptor signaling pathway     109578667 (MAPK3)    04658 Th1 and Th2 cell differentiation     109578667 (MAPK3)    04659 Th17 cell differentiation     109578667 (MAPK3)    04657 IL-17 signaling pathway     109578667 (MAPK3)    04662 B cell receptor signaling pathway     109578667 (MAPK3)    04664 Fc epsilon RI signaling pathway     109578667 (MAPK3)    04666 Fc gamma R-mediated phagocytosis     109578667 (MAPK3)    04062 Chemokine signaling pathway     109578667 (MAPK3)   09152 Endocrine system    04910 Insulin signaling pathway     109578667 (MAPK3)    04929 GnRH secretion     109578667 (MAPK3)    04912 GnRH signaling pathway     109578667 (MAPK3)    04915 Estrogen signaling pathway     109578667 (MAPK3)    04914 Progesterone-mediated oocyte maturation     109578667 (MAPK3)    04917 Prolactin signaling pathway     109578667 (MAPK3)    04921 Oxytocin signaling pathway     109578667 (MAPK3)    04926 Relaxin signaling pathway     109578667 (MAPK3)    04935 Growth hormone synthesis, secretion and action     109578667 (MAPK3)    04919 Thyroid hormone signaling pathway     109578667 (MAPK3)    04928 Parathyroid hormone synthesis, secretion and action     109578667 (MAPK3)    04916 Melanogenesis     109578667 (MAPK3)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     109578667 (MAPK3)    04270 Vascular smooth muscle contraction     109578667 (MAPK3)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     109578667 (MAPK3)   09156 Nervous system    04724 Glutamatergic synapse     109578667 (MAPK3)    04725 Cholinergic synapse     109578667 (MAPK3)    04726 Serotonergic synapse     109578667 (MAPK3)    04720 Long-term potentiation     109578667 (MAPK3)    04730 Long-term depression     109578667 (MAPK3)    04723 Retrograde endocannabinoid signaling     109578667 (MAPK3)    04722 Neurotrophin signaling pathway     109578667 (MAPK3)   09158 Development and regeneration    04360 Axon guidance     109578667 (MAPK3)    04380 Osteoclast differentiation     109578667 (MAPK3)   09159 Environmental adaptation    04713 Circadian entrainment     109578667 (MAPK3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109578667 (MAPK3)    05206 MicroRNAs in cancer     109578667 (MAPK3)    05205 Proteoglycans in cancer     109578667 (MAPK3)    05203 Viral carcinogenesis     109578667 (MAPK3)    05230 Central carbon metabolism in cancer     109578667 (MAPK3)    05231 Choline metabolism in cancer     109578667 (MAPK3)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     109578667 (MAPK3)   09162 Cancer: specific types    05210 Colorectal cancer     109578667 (MAPK3)    05212 Pancreatic cancer     109578667 (MAPK3)    05225 Hepatocellular carcinoma     109578667 (MAPK3)    05226 Gastric cancer     109578667 (MAPK3)    05214 Glioma     109578667 (MAPK3)    05216 Thyroid cancer     109578667 (MAPK3)    05221 Acute myeloid leukemia     109578667 (MAPK3)    05220 Chronic myeloid leukemia     109578667 (MAPK3)    05218 Melanoma     109578667 (MAPK3)    05211 Renal cell carcinoma     109578667 (MAPK3)    05219 Bladder cancer     109578667 (MAPK3)    05215 Prostate cancer     109578667 (MAPK3)    05213 Endometrial cancer     109578667 (MAPK3)    05224 Breast cancer     109578667 (MAPK3)    05223 Non-small cell lung cancer     109578667 (MAPK3)   09164 Neurodegenerative disease    05010 Alzheimer disease     109578667 (MAPK3)    05020 Prion disease     109578667 (MAPK3)    05022 Pathways of neurodegeneration - multiple diseases     109578667 (MAPK3)   09165 Substance dependence    05034 Alcoholism     109578667 (MAPK3)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     109578667 (MAPK3)    04933 AGE-RAGE signaling pathway in diabetic complications     109578667 (MAPK3)    04934 Cushing syndrome     109578667 (MAPK3)   09171 Infectious disease: bacterial    05132 Salmonella infection     109578667 (MAPK3)    05135 Yersinia infection     109578667 (MAPK3)    05133 Pertussis     109578667 (MAPK3)    05152 Tuberculosis     109578667 (MAPK3)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     109578667 (MAPK3)    05170 Human immunodeficiency virus 1 infection     109578667 (MAPK3)    05161 Hepatitis B     109578667 (MAPK3)    05160 Hepatitis C     109578667 (MAPK3)    05171 Coronavirus disease - COVID-19     109578667 (MAPK3)    05164 Influenza A     109578667 (MAPK3)    05163 Human cytomegalovirus infection     109578667 (MAPK3)    05167 Kaposi sarcoma-associated herpesvirus infection     109578667 (MAPK3)    05165 Human papillomavirus infection     109578667 (MAPK3)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     109578667 (MAPK3)    05140 Leishmaniasis     109578667 (MAPK3)    05142 Chagas disease     109578667 (MAPK3)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     109578667 (MAPK3)    01524 Platinum drug resistance     109578667 (MAPK3)    01522 Endocrine resistance     109578667 (MAPK3)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:biu01001]     109578667 (MAPK3)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:biu03036]     109578667 (MAPK3)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:biu04147]     109578667 (MAPK3) Enzymes [BR:biu01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      109578667 (MAPK3) Protein kinases [BR:biu01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    109578667 (MAPK3) Chromosome and associated proteins [BR:biu03036]  Eukaryotic type   Centromeric chromatin formation proteins    SAC (spindle assembly checkpoint) factors     Protein kinases      109578667 (MAPK3) Exosome [BR:biu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109578667 (MAPK3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Choline_kinase Kdo FTA2 NDUF_B4 Motif Other DBs NCBI-GeneID:  109578667 NCBI-ProteinID:  XP_019843641 UniProt:  A0A6P5DZC2 LinkDB All DBs Position 25 AA seq 380 aa AA seqDB search MXAAAAAQGGGGGEPRGTDGVGPGVPGEVEIVKGQPFDVGPRYTQLQYIGEGAYGMVSSA YDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVY IVQDLMETDLYKLLKSQQLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCD LKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEML SNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKS DPKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKER LKELIFQETXRFQPGVLEAS NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atggsggcggcggcggcggctcaggggggcgggggcggggagccccggggaactgatggg gtcggcccgggggtcccaggggaggtagagatagtaaaggggcagccgttcgacgtgggc ccgcgctacacgcagctgcagtacatcggcgagggcgcgtacggcatggtcagctcagct tacgaccacgtgcgcaagactcgagtggccatcaagaaaatcagcccctttgagcatcag acctactgccagcgcacattgcgagagattcagattctgctgcgcttccgccatgagaac gtcattggcatccgagacattctgcgggcacccaccctggaagccatgagggatgtctac atcgtacaggacctgatggagacagacctgtacaaattgctcaaaagccagcagctgagc aacgaccatgtatgctacttcctgtaccagatcctgcggggcctgaagtatatccactcc gccaacgtgctccaccgggatttaaagccctccaacctgctcatcaacaccacctgcgac cttaagatctgtgatttcggtcttgcccggattgctgatcccgagcatgaccacactggc tttctgacggaatacgtggccacacgctggtaccgggccccagagatcatgcttaactcc aagggctacaccaagtccatcgacatctggtctgtgggctgcattctggctgagatgctc tccaaccggcccatcttccccggcaagcactacctggaccagctcaaccacattctgggt attctgggctccccatcccaggaggacctgaattgtatcatcaacatgaaggcccgaaac tacctacagtctctgccctccaagaccaaggtggcctgggccaagctttttcctaagtca gaccccaaagctcttgacctgctggaccggatgttgacctttaaccccaacaaacggatc acagtggaagaagcgctggctcacccctacctggagcagtactatgacccaacggatgag ccagtggccgaggaacctttcaccttcgacatggagctggatgatctacccaaggaacga ctgaaggagctcatcttccaggagacakcccgcttccagcctggggtgctggaagcctcc taa

DBGET integrated database retrieval system