KEGG   Bos indicus (zebu cattle): 109570977
Entry
109570977         CDS       T04792                                 

Gene name
CRKL
Definition
(RefSeq) crk-like protein
  KO
K04438  C-crk adapter molecule crk
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04012  ErbB signaling pathway
biu04015  Rap1 signaling pathway
biu04062  Chemokine signaling pathway
biu04510  Focal adhesion
biu04666  Fc gamma R-mediated phagocytosis
biu04722  Neurotrophin signaling pathway
biu04810  Regulation of actin cytoskeleton
biu04910  Insulin signaling pathway
biu04935  Growth hormone synthesis, secretion and action
biu05100  Bacterial invasion of epithelial cells
biu05135  Yersinia infection
biu05163  Human cytomegalovirus infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05206  MicroRNAs in cancer
biu05211  Renal cell carcinoma
biu05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109570977 (CRKL)
   04012 ErbB signaling pathway
    109570977 (CRKL)
   04015 Rap1 signaling pathway
    109570977 (CRKL)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109570977 (CRKL)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109570977 (CRKL)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    109570977 (CRKL)
   04062 Chemokine signaling pathway
    109570977 (CRKL)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109570977 (CRKL)
   04935 Growth hormone synthesis, secretion and action
    109570977 (CRKL)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    109570977 (CRKL)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109570977 (CRKL)
   05206 MicroRNAs in cancer
    109570977 (CRKL)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    109570977 (CRKL)
   05211 Renal cell carcinoma
    109570977 (CRKL)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109570977 (CRKL)
   05100 Bacterial invasion of epithelial cells
    109570977 (CRKL)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109570977 (CRKL)
   05163 Human cytomegalovirus infection
    109570977 (CRKL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:biu04990]
    109570977 (CRKL)
Domain-containing proteins not elsewhere classified [BR:biu04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   109570977 (CRKL)
SSDB
Motif
Pfam: SH3_2 SH3_1 SH3_9 hSH3
Other DBs
NCBI-GeneID: 109570977
NCBI-ProteinID: XP_019832665
UniProt: A0A6P5D489
LinkDB
Position
17
AA seq 324 aa
MRPAGLLAGVRALGPRAERTPLGRCEEASDHADSRGRQRFLTEATPAAFXDTLVLSSFPQ
LSGSSSNEALEVLHQAARHRGVLTAVQHVIDIRKICVLPNDCALEGGVAECPEAFSTQSV
FFSPCRYPSPPVGSVSAPSLPAAEETLEYVRTLYDFPGNDAEDLPFKKGEILVIVEKPEE
QWWSARNKDGRVGMIPVPYVEKLVRASAQGKPGNRNSSSYGVPEPAHAYAQPQTTAPPPA
AGAPGAAVSPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEV
NGRKGLFPFTHVKIIDPQNPDESE
NT seq 975 nt   +upstreamnt  +downstreamnt
atgcggcctgcaggcctcctggccggagtgagggctctggggccacgtgccgagcgcact
cccctgggacgctgtgaggaagcctcagaccacgccgacagccgtgggcgtcagcgcttt
ctcaccgaggccactcctgctgctttctyggatacgttggtgctaagcagtttccctcag
ttgtcagggtcttcaagtaatgaggccttggaggtgttgcatcaggctgctcgccaccga
ggtgtcctgactgctgtgcagcacgtcattgacatcagaaagatctgcgttttgccaaat
gactgtgctttggagggtggtgtggcagagtgtcctgaggccttctccacccagagtgtt
tttttctctccttgcaggtaccccagcccgccggtgggctctgtgtccgcacccagcctg
cccgccgcggaggagaccctggagtacgtgcggactctgtacgacttccctgggaacgac
gccgaggacctgcccttcaagaagggcgagatcctggtgatcgtcgagaagccggaggag
cagtggtggagcgcccggaacaaggacggccgggtggggatgatccccgtgccctacgtg
gagaagctcgtgcgggcctcggcccagggcaagcctgggaacaggaattccagcagctac
ggggtccccgagcccgcccacgcatacgcacagccgcagaccacggcgcccccaccggcc
gccggcgcccccggggccgcggtcagccccctgccgtccacacagaacggacctgtcttt
gcgaaagcaattcagaaacgcgtgccctgtgcttacgacaagacggccctggccttagag
gtgggtgacatcgtgaaggtcacgaggatgaacatcaacggccagtgggagggcgaggtg
aacgggcgcaaagggctcttccccttcacgcacgtcaagatcatcgacccccagaacccg
gacgagagcgagtga

KEGG   Bos indicus (zebu cattle): 109573847
Entry
109573847         CDS       T04792                                 

Gene name
CRK
Definition
(RefSeq) adapter molecule crk isoform X1
  KO
K04438  C-crk adapter molecule crk
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04012  ErbB signaling pathway
biu04015  Rap1 signaling pathway
biu04062  Chemokine signaling pathway
biu04510  Focal adhesion
biu04666  Fc gamma R-mediated phagocytosis
biu04722  Neurotrophin signaling pathway
biu04810  Regulation of actin cytoskeleton
biu04910  Insulin signaling pathway
biu04935  Growth hormone synthesis, secretion and action
biu05100  Bacterial invasion of epithelial cells
biu05135  Yersinia infection
biu05163  Human cytomegalovirus infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05206  MicroRNAs in cancer
biu05211  Renal cell carcinoma
biu05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109573847 (CRK)
   04012 ErbB signaling pathway
    109573847 (CRK)
   04015 Rap1 signaling pathway
    109573847 (CRK)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109573847 (CRK)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109573847 (CRK)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    109573847 (CRK)
   04062 Chemokine signaling pathway
    109573847 (CRK)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109573847 (CRK)
   04935 Growth hormone synthesis, secretion and action
    109573847 (CRK)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    109573847 (CRK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109573847 (CRK)
   05206 MicroRNAs in cancer
    109573847 (CRK)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    109573847 (CRK)
   05211 Renal cell carcinoma
    109573847 (CRK)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109573847 (CRK)
   05100 Bacterial invasion of epithelial cells
    109573847 (CRK)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109573847 (CRK)
   05163 Human cytomegalovirus infection
    109573847 (CRK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:biu04990]
    109573847 (CRK)
Domain-containing proteins not elsewhere classified [BR:biu04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   109573847 (CRK)
SSDB
Motif
Pfam: SH3_2 SH2 SH3_1 SH3_9 SH3_10 DUF3804
Other DBs
NCBI-GeneID: 109573847
NCBI-ProteinID: XP_019836897
UniProt: A0A6P5DI75
LinkDB
Position
19
AA seq 304 aa
MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHY
IINSSGPRPPVPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSR
SRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRG
MIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPFYA
RVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPD
EDFS
NT seq 915 nt   +upstreamnt  +downstreamnt
atggcgggcaacttcgactcggaggagcggagtagctggtactgggggcggctgagtcgg
caggaggcggtggcgctgttgcagggccagcggcacggggtgttcctggtgcgggactcg
agcactagccccggggactatgtgctcagcgtctccgagaactcgcgcgtctcccactac
atcatcaacagcagcggcccgcgcccgccggtgccaccgtcgcccgcccagcctccgccc
ggggtgagtccctccagactccgaataggagatcaagaatttgattcattgcctgcttta
ctggaattctacaaaatacactatttggacactacaacgttgatagaaccagtttccaga
tccaggcagggtagtggagtgattctcaggcaggaagaggcagagtatgtacgagccctc
tttgactttaatgggaatgatgaagaagatcttccctttaagaaaggagacatcctgaga
atccgggataagcctgaagagcagtggtggaatgcggaggacagcgaaggcaagagaggg
atgattccagtcccttacgtggagaagtatagacctgcctccgcctcagtatcggctctg
attggaggtaaccaggagggttcccacccacagccactgggtgggccggagcctgggccc
tatgcccaacccagcgtcaacactccgctccctaacctccagaatgggcccttttatgcc
agggtaatccagaagcgagtccctaatgcctacgacaagacagccttggctttggaggtc
ggtgagctggtaaaggttacgaagattaatgtgagtggtcagtgggaaggggagtgtaat
ggcaaacgaggtcacttcccattcacacatgtccgtctgctggatcaacagaatcccgat
gaggacttcagctga

DBGET integrated database retrieval system