KEGG   Bos indicus (zebu cattle): 109571002Help
Entry
109571002         CDS       T04792                                 

Gene name
GALNT9
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 9
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00512  Mucin type O-glycan biosynthesis
biu01100  Metabolic pathways
Module
biu_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    109571002 (GALNT9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:biu01003]
    109571002 (GALNT9)
Enzymes [BR:biu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     109571002 (GALNT9)
Glycosyltransferases [BR:biu01003]
 O-Glycan biosynthesis
  Mucin-type
   109571002 (GALNT9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 109571002
NCBI-ProteinID: XP_019832686
LinkDB All DBs
Position
17
AA seq 604 aa AA seqDB search
MAVARKIKTLLTVNILVFVGIILFSVYCRLQDRSEGLVQIVRSADRRVRSRHAKVGALAE
REAILQRLDHLEEVVYNQLNGLAKPIGLVEGPGGLGQGGMAATLRDDSQETEGKFEEYGY
NAQLSDRISLDRTIPDYRPKKCRQMTYSDDLPQISVVFIFVNEALSVILRSVHSVVNHTP
SQLLKEVILVDDNSDNVELKLNLDQYVSKRYPGLVKIVRNSRREGLIRARLQGWKVATAP
VVGFFDAHVEFSTGWAEPALTRIREDRRRIVLPAIDNIKYDTFEVQQYASAAHGYNWGLW
CMYIVPPQDWLDRGDEAAPIRTPAMIGCSFVVDREYFGDIGLLDPGMEVYGGENIELGMR
VWQCGGSMEVLPCSRVAHIERTKKPYNNDIDYYAKRNALRAAEVWMDGFKSHVYMAWNIP
MTNPGVDFGDVSERLALRQRLKCRSFKWYLDNVYPEMRTYNDTLTYGEVRNSKASGYCLD
QGAEDDDRAILYPCHGMSSQLVRYSAEGLLQLGPLGSTAFLPDSKCLVDDGRGRTPALKK
CEDVARPAQRLWDFTQGGPIVSRDTGRCLEVEMSKDANFGLRLVVQRCSGQKWTIRNWIK
PGRH
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggccaggaagatcaaaactttgctgacggtcaacatcctggtgttcgtgggc
atcatcctcttctccgtgtactgccgcctgcaggaccgctcagaggggctggtgcagatc
gttcgcagtgccgaccgccgggtgcgcagccggcacgccaaggtgggcgcgctggctgag
cgcgaagccatcctgcagcgccttgaccacctggaggaggtagtctacaaccagctgaat
ggtcttgccaagcccattggtctggtggaggggccaggaggcctgggccagggcggcatg
gcrgcyacgctgcgggatgacagccaggagacggaaggcaagttcgaggaatacgggtac
aacgcacagctcagcgaccgcatctccctggaccgtaccatcccggactacaggcccaaa
aagtgcagacagatgacctactcggatgacctgccccagatctctgtggtgttcatcttt
gtcaatgaagccctctcmgtcatcctgcgctccgtccacagcgtggtcaaccacacgccc
tcccagctcctcaaggaggtgatcctggtggacgacaacagtgataatgtggaactcaag
ctcaacctggaccaatacgtcagcaagagatacccrggcctggtgaagatcgtccgcaac
agcaggcgagaaggcctgatccgggcrcggttacagggttggaaggtcgccacggccccc
gtcgttggcttctttgatgcccatgtggagttcagcacaggctgggccgagcccgccctt
acgcggatccgrgaggaccgccggcggatcgtcctgccagccatcgacaacatcaagtac
gacacgttcgaggtgcagcaatacgccagcgcagcccacggytacaactggggcctttgg
tgcatgtacatcgtcccgccccaggactggctggaccgcggcgacgaggcrgcgcccatc
aggaccccggccatgatcggctgctccttcgttgtggaccgggagtacttcggggacatt
ggtctgctggacccaggcatggaggtgtatggtggggagaacatagagctgggcatgagg
gtgtggcagtgtggtggcagcatggaggtgctgccctgctcccgcgtggcccacatcgag
cgcaccaagaagccctacaacaacgacatcgactactatgccaagcgcaacgcsctgcga
gcggctgaggtgtggatggacggcttcaagtcccacgtgtacatggcctggaacatcccc
atgactaacccaggcgtggacttcggggacgtgtccgagcggctggccctgcgccagagg
ctgaagtgccgcagcttcaagtggtacctggacaacgtgtacccggagatgaggacgtac
aacgacaccctcacgtacggagaggtgagaaacagcaaagccagcggctactgcttagac
caaggagcggaggacgatgaccgcgccatcctgtacccctgccacgggatgtcctcccag
ctggtgcggtacagcgccgagggcctgctgcagctgggccccctgggctccaccgccttc
ctgcctgactccaagtgcctggtggatgacggcaggggccgcacgcccgccctgaagaag
tgcgaggatgtggcccggcccgcgcagcggctgtgggacttcacccagggyggccccatt
gtgagcagagacacaggccggtgcctggaggtggagatgtccaaggatgccaactttggg
ctccgcctggtggtgcagaggtgctcaggacagaaatggaccatcagaaactggatcaag
ccagggcggcactga

DBGET integrated database retrieval system