KEGG   Bos indicus (zebu cattle): 109571069
Entry
109571069         CDS       T04792                                 

Gene name
PXN
Definition
(RefSeq) paxillin isoform X1
  KO
K05760  paxillin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04062  Chemokine signaling pathway
biu04370  VEGF signaling pathway
biu04510  Focal adhesion
biu04670  Leukocyte transendothelial migration
biu04810  Regulation of actin cytoskeleton
biu05100  Bacterial invasion of epithelial cells
biu05135  Yersinia infection
biu05163  Human cytomegalovirus infection
biu05165  Human papillomavirus infection
biu05170  Human immunodeficiency virus 1 infection
biu05203  Viral carcinogenesis
biu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    109571069 (PXN)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109571069 (PXN)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109571069 (PXN)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    109571069 (PXN)
   04062 Chemokine signaling pathway
    109571069 (PXN)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    109571069 (PXN)
   05203 Viral carcinogenesis
    109571069 (PXN)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109571069 (PXN)
   05100 Bacterial invasion of epithelial cells
    109571069 (PXN)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109571069 (PXN)
   05163 Human cytomegalovirus infection
    109571069 (PXN)
   05165 Human papillomavirus infection
    109571069 (PXN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:biu04990]
    109571069 (PXN)
Domain-containing proteins not elsewhere classified [BR:biu04990]
 LIM domain-containing proteins
  Paxillin family proteins
   109571069 (PXN)
SSDB
Motif
Pfam: LIM Paxillin
Other DBs
NCBI-GeneID: 109571069
NCBI-ProteinID: XP_019832777
UniProt: A0A6P5D784
LinkDB
Position
17
AA seq 935 aa
MSSSLGSNLSELDRLLLELNAVQHNPPGFPADEANSSPPLPGALSTHYGVPENNSLLGGK
AGALTKEKPKRNGGRGLEDLRPSVENLLDELESSVPSPVPTITVNQGEMSSPQRVTSSQQ
QTRISASSATRELDELMASLSDFKTSSSSAVALSSSGLPPGSAPSSHHSLSPPPPAGSSG
GLPPPRKPSPQGHSHTLGVLCAKDNVAPGQLDLAGFGVMPDTPNSRFPSTEGWPGLLSVE
SQAHVWRDPPDLVEELCRVPPGHILPYPGGTGPQDPGAPQAPLANALHPEEAVAATWQGP
WALGVLKPEPPQGAAPNFQEVTEPAVVAVDRQAVFPDXWSLTEERGCQERARPEPGAPES
GRHTPVEDEQLGGETPXXXXXXXXXWGPETPRRPEGTTEVTTEARMDRPELPRAVAVDTP
STTERISTSSQIRSVIRRSRETGHAHPMSREPSPRRRLDPATLSRTPSQERLITELQGRL
GIRPEAEEATGAAGASTEDWLTEGVVITVQPRGRRAGGQLVEKVVFPPGSPIPLRRTFSV
LPSPLPPPSPLLQHRKDASSASSSPPLPSPPTPCGPSGVQSTGTGPQGVGVQGPAPCVAA
PRSVRSIGCQTDEDPLFPPMQIQDLEQRADGELCWAAGWPLNGRQSGPEGQDMGGFMAQG
KTGSSSPPGGPPKPGSQLDSMLGSLQSDLNKLGVATVAKGVCGACKKPIAGQVVTAMGKT
WHPEHFVCTHCQEEIGSRNFFERDGQPYCEKDYHNLFSPRCYYCNGPILDKVVTALDRTW
HPEHFFCAQCGAFFGPEGFHEKDGKAYCRKDYFDMFAPKCGGCARAILENYISALNTLWH
PECFVCRECFTPFVHGSFFEHEGQPYCEAHYHERRGSLCSGCQKPIXGRCITAMAKKFHP
EHFVCAFCLKQLNKGTFKEQNDKPYCQNCFLKLFC
NT seq 2808 nt   +upstreamnt  +downstreamnt
atgagctcctccttgggcagcaacctctccgagctcgaccgcctgctgctggagctgaac
gccgtgcagcataaccccccaggcttccccgcagatgaggccaactccagcccaccactg
ccgggggctctgagcacccactatggcgtcccagagaataacagcctgctagggggcaaa
gctggagcgctgaccaaagagaagcccaaacggaacggtggccggggcctggaggacttg
cggcccagcgtggagaacctcttggatgagctggagagctccgtgcccagccccgtcccc
accatcactgtgaaccagggagagatgagcagtccccagcgagtcacctccagtcagcag
cagacgcgcatctcagcctcctccgccaccagggagctggacgagttgatggcctcgctg
tcggattttaagaccagctcctcctctgctgtggccttgagctcctcggggctgccgccc
ggctcagctccatcctcacaccacagcctctcccctccgcctcctgccgggtcctctgga
ggcctgccaccccctcggaagccctcccctcaaggccacagccacaccctgggcgtcctc
tgcgccaaggacaacgtggcccccggccagctcgatttggctggctttggggtgatgcct
gacacccccaactcaaggtttccctccacagagggttggccagggctgctgagtgtagag
agccaggctcacgtttggagggacccaccagacctggttgaggagctctgcagggtgcct
cctggccacattctaccctaccctgggggcacaggtccccaggatcctggggccccccaa
gcgccattggccaacgctttgcacccggaagaggcggtggctgccacttggcaggggccg
tgggctctgggggtgctcaagcctgagcccccgcagggagctgctcccaacttccaggag
gtcaccgagccggccgtcgtggccgtggaccgtcaggccgtcttccccgatayctggagc
ctcacggaggaacgtggatgtcaggagagggcaaggccagagccaggggcrccggagagc
ggccgccacacccccgttgaggacgagcagctaggtggagagacgccccnnnnnnnnnnn
nnnnnnnnnnnnnnntggggacctgagacccccaggaggccagagggcaccaccgaagtc
accaccgaggccaggatggaccggccagaactcccacgggctgtggccgtggacacgccc
agcaccacggagaggatttccacatctagccagatccgctcggtgatcaggaggagccgg
gagaccggccacgctcaccccatgtcccgggagccctcccctcgccgccggctggacccy
gccaccctaagcagaaccccgtcccaggagcggctcatcaccgagctgcagggtcggctg
ggcatccggccggaggcagaggaggccacgggggccgcaggggcctccactgaggactgg
ctgaccgagggcgtcgtcatcactgtgcagccgcgtgggaggcgggctggggggcagctg
gtggagaaggtcgtcttccctcccggctctcctattcccctgcggagaaccttctctgtt
ctgccttctcctcttcctcctcccagccctctgctccagcaccgcaaagacgcctcctca
gccagcagctctcctcccctgcccagcccgcccaccccctgcggcccctccggggtccag
agcactgggacggggccgcagggagtcggcgtgcagggccccgccccgtgcgtggctgca
ccccgctccgtgaggtccataggctgccagaccgatgaggatccgctcttccccccgatg
cagatccaggacctggaacagagagcagatggcgagctgtgctgggcrgctggctggcct
ctgaacggcaggcagagtggccccgaagggcaggacatgggagggtttatggcccagggg
aagacggggagcagctctcccccagggggccccccgaagcccgggagccagctggacagc
atgctggggagcctgcagtctgacctgaacaaactgggggtcgccacggtcgccaagggg
gtctgcggggcctgcaaaaagccgatcgcgggrcaggtggtgacggccatgggcaagacr
tggcaccccgagcacttcgtctgcacccactgccaggargagatcggctcccggaacttc
tttgagcgggatggacagccctactgtgaaaaggactatcacaacctcttctctccgcgc
tgctactactgcaatgggcccattctggataaagtggtgacagccctcgaccggacgtgg
caccctgagcacttcttctgtgcccagtgtggagccttcttcgggcctgaagggttccac
gagaaagacggsaaggcctactgccgcaaggattactttgacatgtttgcgcccaagtgt
ggcggctgcgcccgggccatcctggagaactacatctcggccctcaacaccctctggcac
cccgagtgctttgtgtgtcgggagtgcttcacgccgttcgtccacggcagcttcttcgag
cacgaggggcagccctactgcgaggcgcaytaccacgagcggcggggctcgctgtgctcg
ggctgccagaagcccatcrcgggccgctgcatcaccgccatggccaagaagttccacccc
gagcacttcgtctgcgccttctgcctcaagcagctcaacaagggcaccttcaaggagcag
aacgacaagccttactgtcagaactgcttcctcaagctcttctgctag

DBGET integrated database retrieval system