KEGG   Bos indicus (zebu cattle): 109571183Help
Entry
109571183         CDS       T04792                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00010  Glycolysis / Gluconeogenesis
biu00053  Ascorbate and aldarate metabolism
biu00071  Fatty acid degradation
biu00280  Valine, leucine and isoleucine degradation
biu00310  Lysine degradation
biu00330  Arginine and proline metabolism
biu00340  Histidine metabolism
biu00380  Tryptophan metabolism
biu00410  beta-Alanine metabolism
biu00561  Glycerolipid metabolism
biu00620  Pyruvate metabolism
biu01100  Metabolic pathways
Module
biu_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109571183 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    109571183 (ALDH2)
   00620 Pyruvate metabolism
    109571183 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    109571183 (ALDH2)
   00561 Glycerolipid metabolism
    109571183 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    109571183 (ALDH2)
   00310 Lysine degradation
    109571183 (ALDH2)
   00330 Arginine and proline metabolism
    109571183 (ALDH2)
   00340 Histidine metabolism
    109571183 (ALDH2)
   00380 Tryptophan metabolism
    109571183 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109571183 (ALDH2)
Enzymes [BR:biu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     109571183 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh HetR_C
Motif
Other DBs
NCBI-GeneID: 109571183
NCBI-ProteinID: XP_019833001
LinkDB All DBs
Position
17
AA seq 520 aa AA seqDB search
MLRAVALAAARLGPRQGRRLLSAATQAVPTPNQQPEVLYNQIFINNEWHDAVSKKTFPTV
NPSTGDVICHVAEGDKADVDRAVKAARAAFQLGSPWRRMDASERGRLLNRLADLIERDRT
YLAALETLDNGKPYIISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDYFSYTRHEPVG
VCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNV
IPGFGPTAGAAIASHEDVDKVAFTGSTEVGHLIQVAAGKSNLKRVTLELGGKSPNIIMSD
ADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYAEFVERSVARAKSRVVGNPFDSRTE
QGPQVDETQFKKVLGYIKSGKEEGAKLLCGGGXAADRGYFIQPTVFGDVQDGMTIAKEEI
FGPVMQILKFKSMEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFG
AQSPFGGYKLSGSGRELGEYGLQAYTEVKTVTVRVPQKNS
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcgctgttgcgcttgccgccgcccgcctcggaccccgccagggccgccgcctg
ctgtccgccgccacccaggccgtgccgacccccaaccagcagcctgaagtcttgtacaac
cagatctttataaacaatgagtggcatgatgccgtcagcaagaaaaccttccccacggtc
aatccatccactggggatgtcatctgtcacgtggctgaaggggacaaggcagacgtggac
agagcagtgaaggctgcccgggccgcattccagctgggctcgccctggcgccgcatggac
gcgtccgagaggggccggctgctgaaccgcctggctgatctgattgagcgagaccggacc
tacttggcagccttggagaccctggacaacggcaagccctatatcatctcctacctggtg
gatctggacatggtcctcaagtgcctgcgttactatgccggctgggctgacaaataccat
gggaaaaccattcccattgacggggactacttcagctacacccgccatgaacctgtggga
gtgtgtgggcagatcatcccatggaacttcccgctcctgatgcaagcctggaaactgggc
ccagccttggcgacgggaaacgtggttgtgatgaaggtggctgagcagactccactcact
gccctctatgtggccaacctgattaaggaggctggctttcctccgggtgtggtcaatgtt
attcctggatttggccccacggcgggagctgccatcgcctcccatgaggacgtggacaaa
gtggctttcaccggctccactgaggttggccacctaatccaggttgctgcggggaagagt
aacctcaagagagtgaccctggagctaggaggaaagagtcccaatatcatcatgtcagat
gctgatatggactgggccgtggagcaggcccacttcgccctgttcttcaaccagggccag
tgctgctgtgcaggctcgcggacctttgtgcaggaggacatttacgccgagtttgtggaa
cggagtgttgcccgggccaagtctcgtgtggttgggaacccctttgacagccggactgag
caggggccgcaggtggatgaaacgcagtttaagaaggtccttggytatatcaaatctggg
aaggaggagggggcgaagctgctgtgtggtggaggggyggctgctgaccgtggctacttc
atccagcccactgtgtttggagacgtgcaagatggcatgaccatcgcaaaggaggagatc
tttgggccagtgatgcagattctgaagttcaagagcatggaggaagtcgtcgggagagcc
aacaattccaagtacgggctggctgcagctgtcttcacgaaggacttggacaaggccaat
tacctgtcccaggccctccaggctggcactgtgtgggtcaactgctatgacgtgtttggg
gcccagtcgccgttcggtggctacaagctgtctgggagtggccgggagctgggggaatac
gggctgcaggcgtacaccgaagtgaagaccgtcacagtcagagttcctcagaagaactcc
taa

DBGET integrated database retrieval system