KEGG   Bos indicus (zebu cattle): 109571221
Entry
109571221         CDS       T04792                                 

Gene name
RANBP1
Definition
(RefSeq) ran-specific GTPase-activating protein
  KO
K15306  Ran-binding protein 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu05166  Human T-cell leukemia virus 1 infection
biu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109571221 (RANBP1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109571221 (RANBP1)
SSDB
Motif
Pfam: Ran_BP1 DUF1681 WH1
Other DBs
NCBI-GeneID: 109571221
NCBI-ProteinID: XP_019833083
UniProt: A0A6P5D4Q1
LinkDB
Position
17
AA seq 206 aa
MAAAKDTHEDHDTSTENADESNHDPQFEPIVSLPEQEIKTLEEDEEELFKMRAKLFRFAS
ENDLPEWKERGTGDVKLLKHKEKGTIRLLMRRDKTLKICANHYITPMMELKPNAGSDRAW
VWNTHADFADECPKQELLAIRFLNAENAQKFKTKFEECRKEIEEKEKKGSGKNDSTEKVV
EKLEALSVQEGEQPQDAAPAAVEEEQ
NT seq 621 nt   +upstreamnt  +downstreamnt
atggcggccgccaaagacacccacgaggaccacgacacctccaccgagaatgctgatgag
tccaaccacgacccccagtttgagccaatagtttctcttcccgagcaagaaattaaaacg
ctggaagaagatgaagaggaactttttaaaatgcgggccaagctgttccggtttgcttca
gagaacgaccttccggagtggaaggagcggggcacgggggacgtcaagctgttgaagcac
aaggagaaggggaccatccgcctgctcatgcgcagggacaagacccttaagatctgcgcc
aaccactacatcacgccgatgatggagctgaagccgaacgcaggcagcgaccgtgcctgg
gtctggaatacccatgccgactttgccgatgagtgccccaagcaggagctcctggccatc
cgcttcctcaacgccgagaatgcacagaaatttaagacgaagtttgaagaatgcaggaaa
gagattgaagagaaagaaaaaaaagggtccggcaagaatgacagcaccgagaaggtggtg
gagaagctcgaggcgctatcggtgcaggagggcgagcagccccaggacgcggccccggcg
gcagtcgaggaggagcagtga

DBGET integrated database retrieval system