KEGG   Bos indicus (zebu cattle): 109571408Help
Entry
109571408         CDS       T04792                                 

Gene name
MGST2
Definition
(RefSeq) microsomal glutathione S-transferase 2 isoform X1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00480  Glutathione metabolism
biu00980  Metabolism of xenobiotics by cytochrome P450
biu00982  Drug metabolism - cytochrome P450
biu00983  Drug metabolism - other enzymes
biu01524  Platinum drug resistance
biu05200  Pathways in cancer
biu05204  Chemical carcinogenesis
biu05225  Hepatocellular carcinoma
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    109571408 (MGST2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    109571408 (MGST2)
   00982 Drug metabolism - cytochrome P450
    109571408 (MGST2)
   00983 Drug metabolism - other enzymes
    109571408 (MGST2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    109571408 (MGST2)
   05204 Chemical carcinogenesis
    109571408 (MGST2)
   05225 Hepatocellular carcinoma
    109571408 (MGST2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    109571408 (MGST2)
  Drug resistance
   01524 Platinum drug resistance
    109571408 (MGST2)
Enzymes [BR:biu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     109571408 (MGST2)
Transporters [BR:biu02000]
 Other Transporters
  Pores ion channels [TC:1]
   109571408 (MGST2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 109571408
NCBI-ProteinID: XP_019833421
LinkDB All DBs
Position
17
AA seq 146 aa AA seqDB search
MAGNSILLAALSVLSACQQSYFAMQVGKARSKYKVTPPSVSGSPDFERIFRAQQNCVEFY
PIFIITLWMAGWYFNQVFATCLGLVYIYSRHQYFWGYAEAAKKRVTGFRLSLGVLALLTV
LGAVGILNSFLDEYLDIDIAKKLRHF
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggcagggaattcgatattgctggctgcactctctgtcctctcagcctgtcagcaaagt
tattttgctatgcaggtaggaaaggcgagatcaaaatacaaagttacgcccccatcagtc
tctgggtcgccagattttgagagaatatttcgtgcacagcaaaactgtgtggagttttac
ccaatattcataatcacattgtggatggctggatggtatttcaaccaagtttttgctact
tgtctgggtctggtgtacatctattcccgtcaycagtatttctggggatacgcagaagct
gctaaaaaaagggtcactggtttccggctgagtctgggggttttggccttattgactgtc
ctaggtgccgtggggattttgaacagctttctggatgaatacctggacatcgatattgcc
aagaaactgaggcacttctaa

DBGET integrated database retrieval system