KEGG   Bos indicus (zebu cattle): 109571527
Entry
109571527         CDS       T04792                                 

Gene name
CD24
Definition
(RefSeq) signal transducer CD24
  KO
K06469  CD24 antigen
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109571527 (CD24)
CD molecules [BR:biu04090]
 Proteins
  109571527 (CD24)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:biu00537]
 Antigens
  109571527 (CD24)
SSDB
Motif
Pfam: CD24 DUF1180
Other DBs
NCBI-GeneID: 109571527
NCBI-ProteinID: XP_019833621
UniProt: A0A6P5D5N9
LinkDB
Position
2
AA seq 77 aa
MGRAIVARLGLGLLLLALLLPTQTYSNQTTVVTPSNSSQTTSPAPHPANATTKASDGTLQ
STASLFVISVSLLHLYC
NT seq 234 nt   +upstreamnt  +downstreamnt
atggggagagcgatcgtagccaggctcggactggggctgctgcttctggcgctgctctta
cctacgcagacttactcaaatcaaacaactgttgtaacaccaagtaactcctcccagact
acctcacctgcccctcatccagccaatgccaccaccaaggcaagcgatggtactctgcag
tcaacagccagtctctttgtgatctcggtctcccttctacatctctactgttaa

DBGET integrated database retrieval system