KEGG   Bos indicus (zebu cattle): 109571543
Entry
109571543         CDS       T04792                                 

Gene name
LIF
Definition
(RefSeq) leukemia inhibitory factor
  KO
K05419  leukemia inhibitory factor
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04630  JAK-STAT signaling pathway
biu04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109571543 (LIF)
   04668 TNF signaling pathway
    109571543 (LIF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109571543 (LIF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109571543 (LIF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109571543 (LIF)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  CSF and other factors
   109571543 (LIF)
SSDB
Motif
Pfam: LIF_OSM
Other DBs
NCBI-GeneID: 109571543
NCBI-ProteinID: XP_019833640
UniProt: A0A6P5D7B8
LinkDB
Position
17
AA seq 202 aa
MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCATRHPCPSNLMNQIRNQLGQLNSSAN
SLFILYYTAQGEPFPNNLDKLCSPNVTDFPPFHANGTEKARLVELYRIIAYLGASLGNIT
RDQKVLNPYAHGLHSKLSTTADVLRGLLSNVLCRLCSKYHVSHVDVTYGPDTSGKDVFQK
KKLGCQLLGKYKQVIAVLAQAF
NT seq 609 nt   +upstreamnt  +downstreamnt
atgaaggtcttggcggcaggagttgtgcccttgctgctggttctccactggaaacacggg
gccgggagcccccttcccatcaccccggtcaacgccacctgtgccacccgccatccctgt
cccagcaacctcatgaaccagatcagaaaccagctgggacaactcaacagcagtgccaac
agcctctttatcctctattacacggcccagggggagcccttccccaacaacctggacaag
ctgtgcagccccaacgtgactgacttcccgcccttccacgccaacggcacagagaaggcc
cggctggtggagctgtaccgcatcatcgcgtacctgggcgcctccctgggcaacatcacg
agagaccagaaggtcctcaacccctacgcccacggcctgcacagcaagctgagcaccacg
gccgacgtcctgcggggtctgctcagcaacgtgctctgccgcttgtgcagcaagtaccac
gtgagccacgtggacgtgacctacggccccgacacctcgggcaaggacgtcttccagaag
aagaagctgggctgtcagctcctggggaagtacaagcaggtcatcgccgtgctggcccag
gccttctag

DBGET integrated database retrieval system