KEGG   Bos indicus (zebu cattle): 109571796
Entry
109571796         CDS       T04792                                 

Definition
(RefSeq) myeloid cell surface antigen CD33-like
  KO
K06473  CD33 antigen
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109571796
CD molecules [BR:biu04090]
 Proteins
  109571796
Lectins [BR:biu04091]
 I-type lectins (Siglecs)
  109571796
SSDB
Motif
Pfam: V-set ig Ig_3 Ig_2 C2-set_2 I-set
Other DBs
NCBI-GeneID: 109571796
NCBI-ProteinID: XP_019833876
UniProt: A0A6P5D6H0
LinkDB
Position
18
AA seq 233 aa
MPPLLLPLLWAGSLALXPNYWLKAPRSVSVQEGLCVRVPCSVYYPSDFHSGSTXVHGFWF
REGAEVLKDAPVATNKLDREVQKETQGRFHLLGDPRDNNCSLEIRDARKSDRGSYFFRVE
RGSMKWSYLSELFFLNVTALTHQPHVLSPGDLEPGQPGNMTCSVPWACERATPPIFSWTS
AAPSSLGPRTPFSSVLTLTPRPQDHGTRLTCQVKLPTSGAMVEXTILLNVTCE
NT seq 702 nt   +upstreamnt  +downstreamnt
atgccgccgctgctgctgccgctgctgtgggcggggtccttagctctgnntccgaattac
tggctgaaagcaccgcggtccgtgtcggtgcaggagggcttgtgtgtccgcgtgccctgc
tccgtctactatcccagcgacttccacagtggttctacccytgttcacggcttctggttc
cgggaaggggccgaagtactcaaggatgcccccgtggccacaaacaaattagaccgtgaa
gttcagaaggagacccagggccgattccacctcctcggggaccccagggacaacaaytgc
tccctggagatcagagatgccagraagagygacagaggttcctacttttttcgtgtggaa
agaggaagtatgaaatggagttacctgtctgaactgttcttcttgaatgtgacagccctc
acccaccagccccaygtcctcagccccggggacctggagcccggccaacccgggaacatg
acctgctctgtgccctgggcctgtgagcgggccacgccgcccatcttctcctggacgtca
gctgcccccagctccctgggccccaggacccccttctcgtcrgtgctcactctcacccca
cggccccaggaccacggcaccaggctcacctgtcaggtgaagctccccacaagcggggcg
atggtggagcrraccatcctgctcaatgtcacctgtgagtga

KEGG   Bos indicus (zebu cattle): 109571913
Entry
109571913         CDS       T04792                                 

Definition
(RefSeq) myeloid cell surface antigen CD33-like
  KO
K06473  CD33 antigen
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109571913
CD molecules [BR:biu04090]
 Proteins
  109571913
Lectins [BR:biu04091]
 I-type lectins (Siglecs)
  109571913
SSDB
Motif
Pfam: V-set ig Ig_2 Ig_3 C2-set_2 I-set
Other DBs
NCBI-GeneID: 109571913
NCBI-ProteinID: XP_019833993
UniProt: A0A6P5D706
LinkDB
Position
18
AA seq 366 aa
MLPLLLPLLLPLLWAATLAQDPNYWLKAPRSVSVQEGLCVXVPCSVYYPSDFRSGSTPVH
GFWFREGAEVLKDAPVATNKLDREVQKETQGRFHLLGDPRDNNCSLEIRDARKSDRGSYF
FRMEKGSMKWSYLSELFFLNVTAFTHQPHLLSPGDLEPGHPGNLTCSVPWACERXMPPIF
SWTSAAPSSLGPRTPFSSVLTLTPRPQDHGTRLTCQVKFPRSGVMVERTILLNVTYASRN
PGNICTGDGTGESGTGAGVTEGAIAGAGVTMLLVLCFGLIFFVVKIYRKKVAKTAVDMED
IYSAAEPASLDHQQESKSEESSDPTNYAGTTPSLELEQELHYSSIIFRGEKPQESPHSEY
AEIRIK
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgctgccgctgctgctgccgctgctgctgccgctgctgtgggcggcgaccctggctcag
gatccgaattactggctgaaagcaccgcggtccgtgtcggtgcaggagggcttgtgtgtc
crcgtgccctgctccgtctactatcccagcgacttccgcagtggttctacccctgttcac
ggcttctggttccgggaaggggccgaagtactcaaggatgcccccgtggccacaaacaaa
ttagaccgtgaagttcagaaggagacccagggccgattccacctcctcggggaccccagg
gacaacaaytgctccctggagatcagagatgccagaaagagcgacagaggttcctacttt
tttcgtatggaaaaaggaagtatgaaatggagttacctgtctgaactgttcttcttgaat
gtgacagccttcacccaccagccccacctcctcagccccggggacctggagcccggccac
cccgggaacctgacctgctctgtgccctgggcctgtgagcgggmcatgccgcccatcttc
tcctggacgtcagctgcccccagctccctgggccccaggacccccttctcgtcggtgctc
accctcaccccacggccccaggaccacggcaccaggctcacctgtcaggtgaagttcccc
agaagtggggtgatggtggagcggaccatcctgctcaatgtcacctatgcttcacggaac
ccaggcaatatctgcacaggggatggcacaggggaatcagggacaggggcaggagtgact
gagggggccatcgcgggagctggcgtcaccatgctgcttgttctctgcttcggcctcatc
ttcttcgtagtgaagatctacaggaagaaggtagccaagaccgcagtggacatggaggac
atctactctgccgcagagccagcttccctggatcaccagcaggagtccaagtcagaggaa
tcttctgaccccacaaattatgcagggaccaccccctctttggagttggagcaggagttg
cattattcctccatcatcttccgtggggagaagcctcaggagagccctcactcagaatac
gcagagatcaggatcaagtga

DBGET integrated database retrieval system