KEGG   Bos indicus (zebu cattle): 109571848Help
Entry
109571848         CDS       T04792                                 

Gene name
EPN1
Definition
(RefSeq) epsin-1
  KO
K12471  epsin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109571848 (EPN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109571848 (EPN1)
Membrane trafficking [BR:biu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    109571848 (EPN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ENTH ANTH UIM VHS
Motif
Other DBs
NCBI-GeneID: 109571848
NCBI-ProteinID: XP_019833920
LinkDB All DBs
Position
18
AA seq 528 aa AA seqDB search
MSTSSLRRQVKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMI
WKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVSQQCKENMYAVQTLKDFQYVDRDGKDQG
VNVREKARQLVALLRDEDRLREERAHALKTKEKLAQTATASSAAVGSGPPPEAEQAWPQS
SGEEELQLQLALAMSKEEADQPPSCGPEDDAQLQLALSLSREEHDKEERIRRGDDLRLQM
AIEESKRETAGQEESSLMDLADVFTAPAAAPATDPWGAPVSMAAALPTAAPASDPWGGPP
VPQAADPWGGPAPTPASGDPWRPAAPAGPPADPWGGTQAPAAGEGPAPDPWGGSDGGAPV
SGPPXSDPWAPAPAFSDPWGGSPAKPSTNGTAVVGGFDTEADEFSDFDRLRTALPASGSS
TGELELLAGEVPARSPGAFDMSGVGGSLAEAVGIALLPAGAPATGPSITNPFQPAPPATL
TLNQLRISPVPPVAGAPSTYISPLGGGPGLPPMMPPGPPAPNTNPFLL
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacctcctcgctgcggcgccaggtgaagaacatcgtccacaactactcggaggcc
gagatcaaggtgcgtgaggccacgagcaacgacccctggggcccgtccagctcgctcatg
tccgagatcgctgacctcacctacaatgtggtcgccttctccgagatcatgagcatgatc
tggaagcggctcaacgaccacggcaagaactggcggcacgtctacaaggccatgacactg
atggagtacctcatcaagacgggctcggagcgcgtgtcacagcagtgcaaggagaacatg
tacgctgtgcagacgctgaaggacttccagtacgtggaccgcgatggcaaggaccagggt
gtgaatgtgcgtgagaaggccaggcagctggtggccctgctgcgtgacgaggaccggctg
cgggaggagcgtgctcacgcactcaaaaccaaggagaagctggcgcagactgccacagct
tcctccgcagccgtgggctccgggcccccgcccgaggcggagcaggcctggccacagagc
agcggggaggaggagctgcagctgcagctggcgctggccatgagcaaggaggaggccgac
cagcccccgtcctgcggccccgaggatgacgcccagctccagctggcccttagtttgagc
cgcgaggagcacgataaggaggagcggatccgccgtggggacgacctgcgcctgcagatg
gccatagaggagagcaagagggagacggcaggccaggaggagtcatccctcatggatctt
gctgacgtcttcacggccccggctgctgctcctgccactgatccctggggggcccctgtg
tccatggctgctgccctccccacagctgcccccgcctcggacccttgggggggacctcct
gtccctcaggctgctgatccttgggggggtccagcccctaccccggcctctggggacccc
tggaggcctgctgcccctgcagggcccccagctgacccttggggggggacccaggcccct
gcggctggagaaggaccagcacccgacccgtgggggggctctgatggtggggccccagtt
agcggacccccggyctctgacccctgggccccagctccggccttctcagacccctggggg
gggtcccctgccaagcccagcaccaatggcactgcagtggttgggggctttgatacggag
gccgacgagttctctgacttcgaccgcctgcgcacggccctgccggcctctgggagcagc
acaggggagctggagctgcttgccggagaggtgcccgcccgcagccctggcgccttcgac
atgagcggggtcgggggctctctggctgaggctgtggggatcgccctcctccccgcagga
gccccggccaccggcccctccatcaccaaccccttccagcctgcgccccccgcgacgctc
accctgaaccagctccggatcagccccgtgcccccagtcgcgggagcgccgtccacgtac
atctctcccctcggcgggggccctggcctgccccctatgatgcctccgggacccccggcc
cccaacactaaccccttcctcctataa

DBGET integrated database retrieval system