KEGG   Bos indicus (zebu cattle): 109571966Help
Entry
109571966         CDS       T04792                                 

Definition
(RefSeq) glycogen [starch] synthase, muscle
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00500  Starch and sucrose metabolism
biu01100  Metabolic pathways
biu04151  PI3K-Akt signaling pathway
biu04152  AMPK signaling pathway
biu04910  Insulin signaling pathway
biu04922  Glucagon signaling pathway
biu04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:biu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    109571966
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    109571966
   04152 AMPK signaling pathway
    109571966
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    109571966
   04922 Glucagon signaling pathway
    109571966
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    109571966
Enzymes [BR:biu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     109571966
Glycosyltransferases [BR:biu01003]
 Polysaccharide
  Storage polysaccharide
   109571966
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glycos_transf_1 Glyco_trans_4_4 Glyco_trans_1_4 Glyco_transf_5
Motif
Other DBs
NCBI-GeneID: 109571966
NCBI-ProteinID: XP_019834048
LinkDB All DBs
Position
18
AA seq 736 aa AA seqDB search
MPLNRTLSMSSLPGLEDWEDEFDLENTVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYYLVGPYTEQGVRTQVELLEPPTPALKRTLDSMNSKGCKVYFGRWLIEGGXXXXXLDVG
ASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQSEEKPHVVALFH
EWLAGVGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH
RYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALAKAFPEYFTYEPHEADATQGYRYPRPASVPPSPSLSRHSSPHQSEDE
EEPRDLPPDEDDERYDEDEEAAKDRRNIRAPEWPRRASCTSSTGSKRGSVDTAPSSSVST
PSEPLSPASSLGEERN
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgcctctaaaccgcactttgtccatgtcctccctgccaggactggaggactgggaggat
gaattcgacctggagaacacagtgctcttcgaggtggcctgggaggtggccaacaaggtg
ggcgggatctacacagtgctgcagacgaaggcaaaggtgacgggggacgagtggggtgac
aactactacctggtgggaccgtacacggagcagggcgtgaggacccaggtggagctgctg
gaacccccgaccccggccctgaagaggacgctggactccatgaacagcaagggctgcaag
gtgtacttcgggcgctggctgattgaggggggnnnnnnnnnnnnnntcctcgatgtgggg
gcctcagcctgggccctggagcgctggaagggggagctatgggacacatgcaacatcggg
gtgccctggtacgaccgggaggccaacgacgccgtcctttttggcttcctcaccacctgg
ttcctgggtgagttcctggcccagagcgaggagaaaccacacgtggtcgcactcttccac
gagtggttggcaggtgtcgggctctgcctgtgccgcgcccggcggctgcccgtggctacc
atcttcaccacccacgccacgctgctggggcgatacctgtgtgctggggctgtggacttc
tacaacaacctggagaatttcaacgtggacaaagaagcaggtgagaggcaaatctatcac
cgctactgcatggagcgggccgcagcccactgcgctcatgtcttcactactgtgtcccag
attaccgccattgaggctcagcacctactcaaaaggaaaccagatatcgtgacccccaat
ggactgaatgtgaagaaattctctgccatgcatgagttccagaacctccatgctcagagc
aaggctcgaatccaggagtttgtgcggggccatttttatgggcacctagacttcaacttg
gacaagaccttgtacttctttatcgccggccgctatgagttctccaacaagggggccgac
gtcttcctggaggccttggcccggctcaactatctgctcagagtgaatggcagtgagcag
acggtggtcgccttcttcatcatgccggctcggaccaacaatttcaacgtggaaaccctt
aagggccaggccgtgcgcaagcagctttgggatacggccaacacagtgaaggaaaagttt
gggaggaagctttacgaatccttgctggtggggagcctcccagacatgaacaagatgctg
gacaaggaggacttcactatgatgaagagagctatctttgccacacagcggcaatctttc
cctcctgtgtgcacccacaatatgctggatgactcctcagaccccatcttgacaaccatc
cgccgaatcggcctctttaatagtagtgctgacagagtcaaggtgatttttcacccggag
ttcctgtcttctacgagccctctgctccctgtggactatgaggaatttgtccgtggctgc
caccttggggtcttcccctcctactatgagccttggggctacacaccagctgaatgcacg
gtaatgggtatccccagtgtctccaccaacctctccggattcggctgcttcatggaggaa
cacatcgcagacccctcagcttacggtatctacattctggaccggcgattccgcagtctg
gatgattcctgctcgcagctcacctccttcctctacagtttctgccagcagagccgaagg
cagcgcattatccagcggaaccgaacggagcgcctctctgaccttctggactggaaatac
ctaggccggtactacatgtcagcgcgccacatggcgctggccaaggcctttccagaatac
ttcacctacgagcctcacgaggctgacgcgacccagggctaccgctacccacggccagcc
tcagtgccaccatcaccctcgctgtcgcgacactccagcccgcaccagagcgaggatgag
gaggaaccccgggacttaccacctgatgaagatgacgagcgctacgacgaggacgaggag
gccgccaaggaccggcgcaacatccgcgcccccgagtggccacgccgcgcctcctgcacc
tcttccaccgggagcaagcgtgggtctgtggacacagcgccctccagctcagtcagcacc
cccagcgaaccccttagccccgccagctccctgggggaggaacgcaactaa

DBGET integrated database retrieval system