KEGG   Bos indicus (zebu cattle): 109572224
Entry
109572224         CDS       T04792                                 

Gene name
IRF3
Definition
(RefSeq) interferon regulatory factor 3 isoform X1
  KO
K05411  interferon regulatory factor 3
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04623  Cytosolic DNA-sensing pathway
biu05133  Pertussis
biu05135  Yersinia infection
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05171  Coronavirus disease - COVID-19
biu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109572224 (IRF3)
   04621 NOD-like receptor signaling pathway
    109572224 (IRF3)
   04622 RIG-I-like receptor signaling pathway
    109572224 (IRF3)
   04623 Cytosolic DNA-sensing pathway
    109572224 (IRF3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109572224 (IRF3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109572224 (IRF3)
   05133 Pertussis
    109572224 (IRF3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109572224 (IRF3)
   05161 Hepatitis B
    109572224 (IRF3)
   05160 Hepatitis C
    109572224 (IRF3)
   05171 Coronavirus disease - COVID-19
    109572224 (IRF3)
   05164 Influenza A
    109572224 (IRF3)
   05162 Measles
    109572224 (IRF3)
   05168 Herpes simplex virus 1 infection
    109572224 (IRF3)
   05163 Human cytomegalovirus infection
    109572224 (IRF3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109572224 (IRF3)
   05169 Epstein-Barr virus infection
    109572224 (IRF3)
   05165 Human papillomavirus infection
    109572224 (IRF3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109572224 (IRF3)
   04131 Membrane trafficking [BR:biu04131]
    109572224 (IRF3)
Transcription factors [BR:biu03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    109572224 (IRF3)
Membrane trafficking [BR:biu04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    109572224 (IRF3)
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 109572224
NCBI-ProteinID: XP_019834368
UniProt: A0A6P5D7X3
LinkDB
Position
18
AA seq 417 aa
MGTQKPRILPWLISQLDRGELEGVAWLGESRTRFRIPWKHGLRQDAQQEDFGIFQAWAVA
SGAYTPGKDKPDLPTWKRNFRSALNRKEVLRLAEDHSKDSQDPHKIYEFVNSGVRDIPEP
DTSQDNGRHNTSDTQEDTLEKLLSDMDLSPGGPSNLTMASENPPQFLQSPDSDIPALCPN
SGLSENPLKQLLANEEDWEFEVTAFYRGCQVFQQTVFCPGGLRLVGSEAGDRMLPGQPIR
LPDPATSLTDKSVTDYVQRVLSCLGGGLALWRAGQWLCAQRLGHCHVYWAIGEELLPSCG
HKPDGEVPKDREGGVFNLGPFITDLITFIEGSRRSPLYTLWFCVGQSWPQDQPWIKRLVM
VKVVPMCLRVLVDIARQGGASSLENTVDLHISNSDPLSLTPDQYMACLQDLAEDMDF
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgggaacccaaaagcctcggatactgccctggctgatatctcagctggaccgaggggag
ttggagggcgtggcctggctgggcgagagccgcacgcgtttccgcatcccttggaagcac
ggcttgcggcaggatgcccagcaggaggatttcggcatcttccaggcctgggctgtagcc
agtggtgcctatactcctgggaaggataagcccgacctgccgacctggaagaggaatttc
cggtctgccctgaaccggaaggaagtgttgcgtttagcggaggaccacagcaaggactcc
caagacccacacaaaatctatgagtttgtgaactcaggagtcagggacatccctgagcca
gatacctctcaagacaatggcagacacaatacctctgatacccaggaagacactctggag
aagttactgagtgacatggacttgagcccaggagggccctcgaatctgactatggcctct
gagaacccccctcagttcttgcagagtcccgactcagacatccctgctctttgcccaaac
tcgggactctctgaaaaccccctgaagcagctgttggcaaacgaggaagattgggagttc
gaggtgactgccttctaccggggctgccaagtcttccagcagactgtcttctgccctggr
ggcctgcggctggtgggatcagaagcaggggacaggatgctgcctgggcagcctatacga
ctgccggaccctgcgacgtccctgacagacaagagcgtgacagactacgtgcagcgtgtg
ctgagctgcctgggcggggggctggccctgtggcgggccgggcagtggctctgcgcccag
aggctggggcactgccacgtgtactgggccataggcgaggagctcctccctagctgtggc
cacaagcctgacggcgaggtcccgaaggacagggaaggaggtgtgttcaacctggggccc
ttcataacagatctgatcaccttcattgaaggaagcagacgttcaccactctataccctc
tggttctgtgtggggcagtcatggccccaggaccagccatggatcaagaggcttgtgatg
gtcaaggttgtccccatgtgtctcagggttcttgtagacatagcgcggcaagggggtgcc
tcctccctggagaacactgtcgacctgcacatttccaatagcgaccccctctccctcacc
ccagaccagtacatggcctgcctccaggacctggccgaagacatggatttctag

DBGET integrated database retrieval system