KEGG   Bos indicus (zebu cattle): 109572446
Entry
109572446         CDS       T04792                                 

Gene name
RBL2
Definition
(RefSeq) retinoblastoma-like protein 2 isoform X1
  KO
K16332  retinoblastoma-like protein 2
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04068  FoxO signaling pathway
biu04110  Cell cycle
biu04151  PI3K-Akt signaling pathway
biu04218  Cellular senescence
biu05165  Human papillomavirus infection
biu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109572446 (RBL2)
   04151 PI3K-Akt signaling pathway
    109572446 (RBL2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109572446 (RBL2)
   04218 Cellular senescence
    109572446 (RBL2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109572446 (RBL2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109572446 (RBL2)
Transcription factors [BR:biu03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    109572446 (RBL2)
SSDB
Motif
Pfam: RB_A RB_B DUF3452 SLH
Other DBs
NCBI-GeneID: 109572446
NCBI-ProteinID: XP_019834783
UniProt: A0A6P5DBE1
LinkDB
Position
18
AA seq 1083 aa
MDEAARAEAWESYRSMSESYTLEGNDLHWLACALYVACRKSVPTVSKGTVEGNYVSLTRI
LRCSEQSLIEFFNKMKKWEDMANLPPHFRERTERLERNFTVSAVIFKKYEPIFQDIFKYP
QEEQPRQQRGRKQRRQPCTVSEVFHFCWVLFIYAKGNFPMISDDLVNSYHLLLCALDLVY
GNALQCSNRKELVNPNFKGLSEDFHAKDSKPSSDPPCVIEKLCSLHDGLVLEAKGIKEHF
WKPYIRKLYEKKLLKGKEENLTGFLEPGNFGESFKAINKAYEEYVLSVGNLDERIFLGED
AEEEIGTLSRCLNTGSGAETAERVQMKNILQQHFDKSKALRVSTPLTXVRYIKDSSPCVT
PVSTATHSLSRLHTMLTGLRNAPSERLEQTLRSCSRDPTQAIANRLKEMYEIYSQHFQSE
EDGSNCAKDIASKHFRFAEMLYYKVLESVIEQEQKRLGDMDLSGILEQDAFHRSLLACCL
EVVTFSYKPPGNFPFITEIFDVPLYHFYKVIEVFIRAEDGLCREVVKHLNQIEEQILDHL
AWKPESPLWDRIRDNENRVPTCEEVMPPQNLERADEICIAGSPLTPRRVSEVRADSGGLG
RSISSPTTLYDRYSSPTASSTRRRLFVENDSPTDGGTPGRTPPQPLVNAVPVQNVAGEAV
SVTPVPGQTLVTMATATVTANNGQTVTIPVQGIANENGGITFFPVQVNVGGQAQAVTGSI
QPLSAQALAGSLSSQQVTGTTLQVPGQVAIQQISPGGPQQKQGLPLTSSSIRPRKTSSLS
LFFRKVYHLAGVRLRDLCAKLDISDELRKKIWTCFEFSIIQCPELMMDRHLDQLLMCAIY
VMAKVTKEDKSFQNIMRCYRTQPQARSQVYRSVLIKGKRRRRNSGSSDSRSHQNSPTELN
KDRTSRDSSPVMRSSSTLPVPQPSSAPPTPTRLTGANSDVEEEERGDLIQFYNNIYIRQM
KTFAMKYSQANAMDAPPLSPYPFVRTGSPRRIQLSQNHPVYISPHKNEAMLSPREKIFYY
FSNSPSKRLREINSMIRTGETPTKKRGILLEDGSESPAKRICPENHSALLRRLQDVANDR
GSH
NT seq 3252 nt   +upstreamnt  +downstreamnt
atggacgaggcggcgcgggccgaggcctgggagagctaccggagcatgagcgagagctac
acgctggagggaaatgatcttcattggttagcatgtgccttatatgtggcttgcagaaaa
tctgtgccaactgtaagcaaggggacagttgaaggaaactatgtatctttaactcgaatc
ctgagatgttctgagcagagcttaattgaattctttaacaagatgaagaaatgggaagac
atggccaatctccctccacatttcagagaacgtactgagagattagaaagaaacttcact
gtttctgctgtaatttttaagaaataygaacccatctttcaggacatttttaaatatcct
caagaagagcagccgcgtcagcagagaggaagaaaacagcggcgacagccctgtaccgtg
tctgaagttttccatttttgttgggtgctttttatatatgcaaaaggtaattttcccatg
attagtgatgatttggttaattcttatcatcttctgctgtgtgctttggacttagtttat
ggaaatgcccttcaatgttccaatcgtaaagaacttgtgaaccctaattttaaaggtcta
tctgaagattttcatgctaaggattctaaaccttcctccgacccaccttgcgtcattgag
aaactgtgttccttacatgatggcttagttttggaagcaaaaggaataaaggaacatttc
tggaaaccttatattaggaaactttatgaaaaaaagctccttaagggaaaagaagaaaat
ctgactggttttttagaacctgggaattttggagagagttttaaagccatcaataaagcc
tatgaggagtatgttttatctgttgggaatttagacgagcggatttttctgggcgaggat
gctgaagaggaaattgggactctctcaaggtgcctgaacactggttcaggagcagagacc
gctgagagggtgcagatgaaaaacatcctgcagcagcacttcgacaagtctaaagcactt
agagtctccacaccacttaccrgtgtgaggtacattaaggacagcagcccttgtgtgact
ccagtttctacagctacacatagcttgagtcgccttcacaccatgctcacgggcctcagg
aatgcaccgagtgagagactggaacagaccctaaggtcatgttccagagatccaacccag
gctattgccaacagattgaaagaaatgtatgagatatattcycagcatttccagtcagag
gaggatggcagtaattgtgctaaagatattgccagcaaacattttcgttttgcagagatg
ctttactataaagtattagaatctgttattgagcaggaacaaaaaagactgggagacatg
gatttatctggcattctggaacaagatgcattccacagatcactcttggcgtgctgcctt
gaggtcgtcactttttcttataagcctcctgggaattttccatttattactgaaatattc
gatgtgccactttatcatttttacaaggtgatagaagtattcattagagcagaagatggc
ctttgtagagaggtggtaaaacaccttaatcagattgaagaacaaatcttggatcattta
gcctggaaaccagagtctccgctctgggacaggattagagacaatgaaaacagagttccc
acatgcgaagaggtcatgccacctcagaacctggaaagagcagatgaaatttgtattgct
ggctcccctctgactcccagaagggtgagtgaagttcgtgctgattctggaggactygga
agaagcatatcatctccaaccacgctgtatgataggtacagctccccaacagccagttct
accaggaggcggctatttgtggagaatgacagccccactgatggagggacccccgggcgc
actcccccgcagcctctagtcaatgctgtccccgtgcagaatgtagctggggaggctgta
tctgtcacaccggttcctggacagaccttggtcaccatggcaacagccacagtcacagcc
aacaatggacaaacagtgaccattcctgtacaaggtattgccaatgagaatggaggaata
acgttcttcccagtccaagtcaatgttggggggcaggcgcaagctgtgaccggctccatc
cagcccctcagtgctcaggccctggctggaagcttaagctcrcaacaggtgacaggaaca
accttgcaagtccctggtcaggtggccattcaacagatttcccctggtggaccacagcag
aaacaaggcctacctttaaccagcagcagtatcagacccaggaagacaagctctttatcg
cttttctttaggaaggtttatcacttagcaggtgtccgccttcgggatctttgtgctaaa
ttggatatttcagatgaactgaggaaaaaaatctggacctgctttgaattctccataatt
cagtgtcctgaacttatgatggacagacatctggaccagttgttaatgtgtgccatttat
gtgatggcaaaggtcacaaaagaagacaagtccttccagaatattatgcgttgctatagg
actcagccacaggcccggagccaggtgtatagaagtgttttgataaaagggaaaaggaga
agaagaaattctggcagcagtgacagcagaagtcatcagaattctccgacagaactaaac
aaagacagaaccagcagagactccagtcctgtcatgaggtccagcagcaccttgccagtc
ccacagccgagcagcgcccctcctaccccgactcgcctcacgggggccaacagtgacgtg
gaggaggaggagaggggggacctcatccagttctacaacaacatctatatcagacagatg
aaaacgtttgccatgaagtactcacaggcaaatgcaatggatgctcctccactctctccc
tatccatttgtaagaacaggctctcctcgccgaatacagttgtctcagaaccatcctgtc
tacatttccccgcataaaaatgaagcgatgctttctcctcgagaaaagattttctactac
ttcagcaacagcccttcaaagagactgagagaaattaacagtatgatacggacaggagaa
accccaaccaaaaagagagggatccttttggaagatggaagtgaatcacctgcaaaaaga
atctgcccagaaaatcattctgccttattacgtcgyctccaagatgtagctaatgaccgg
ggttcccactga

DBGET integrated database retrieval system