KEGG   Bos indicus (zebu cattle): 109572635
Entry
109572635         CDS       T04792                                 

Gene name
VAC14
Definition
(RefSeq) protein VAC14 homolog
  KO
K15305  vacuole morphology and inheritance protein 14
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu05166  Human T-cell leukemia virus 1 infection
biu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109572635 (VAC14)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109572635 (VAC14)
SSDB
Motif
Pfam: Vac14_Fig4_bd Vac14_Fab1_bd HEAT HEAT_EZ TAF6_C
Other DBs
NCBI-GeneID: 109572635
NCBI-ProteinID: XP_019835147
UniProt: A0A6P5DDI7
LinkDB
Position
18
AA seq 783 aa
MNPEKDFAPLTPNIVRALNDKLYEKRKVAALEIEKLVREFVAQNNTVQIKHVIQTLSQEF
ALSQHPHSRKGGLIGLAACSIALGKDSGLYLKELIEPVLTCFNDADSRLRYYACEALYNI
VKVARGAVLPHFNVLFDGLSKLAADPDPNVKSGSELLDRLLKDIVTESNKFDLVGFIPLL
RERIYSNNQYARQFIISWILVLESVPDINLLDYLPEILDGLFQILGDNGKEIRKMCEVVL
GEFLKETKKSPSSVKFAEMANILVIHCQTTDDLIQLTAMCWLREFIQLAGRVMLPYSSGI
LTAVLPCLAYDDRKRNIKEVASVCNQSLMKLVTPEDDEPDEPRPVVQKQAGPSPEDCAAK
QEGAASGGPDGSCDSSFSSGISVFTPASAERAPVTLHLDGIVQVLNCHLSDTAIGMMTRI
AVLKWLYHLYIKTPRKMSXHTDSLFPVLLQTLSDESDEVILKDLEVLAEIASSPAGQTDD
PGPLDGPDLRVSHSELQAPTPGRAGLLNTPGTKGLECSPSTPTMNSYFYKFMINLLKRFS
SERKLLEVRGAFIIRQLCLLLHAESIFHSMADILLREEDLTFASTMVHTLNTILLTSTEL
FQLRNQLKDLKTPESRNLFCCLYRSWCHNPVTTVSLCFLTQNYRHAYDLIQKFGDLEVTV
DFLTEVDKLVQLIECPIFTYLRLQLLDVKSNPYLIKALYGLLMLLPQSSAFQLLSHRLQC
VPNPELLQTEDGLKAAPKSQKADSPSIDYAELLQHFERVQKKHLEVRHQRSGRGDHLDRR
VVL
NT seq 2352 nt   +upstreamnt  +downstreamnt
atgaacccggagaaggatttcgcgccgctcacgcccaacatcgtgcgcgccctcaacgac
aagctctacgaaaagcggaaggtggctgccctggagatcgagaagctggtccgagagttc
gtggcccagaacaacacggtgcagatcaagcatgtgatccagaccttgtctcaggagttt
gccctatctcagcacccccacagccggaaaggtgggctcatcggcctggccgcctgctcc
atcgcactgggcaaggactcggggctctacctaaaggagctgatcgagccggtgctcacc
tgcttcaacgaygccgacagcaggctgcgatactacgcctgtgaggccctctacaacatc
gtcaaggtggcccgaggcgccgtgctgccccacttcaacgtgctcttcgatgggctgagc
aagttggctgctgacccagaccccaatgtgaaaagcggatctgagctcctagaccgcctc
ttaaaggacatcgtgacggagagcaacaagtttgacctggtgggcttcatccccttgttg
cgggagaggatttactccaacaaccagtacgcccggcagttcatcatctcctggatcctg
gtgctggagtccgtgcccgacattaacctcctggactacctgccagagatcctggacggg
ctcttccaaatcctgggcgacaatggcaaagagatccggaaaatgtgtgaggtggtcctt
ggggagttcctgaaggaaacgaagaagagcccctcgagtgttaagtttgcygagatggcc
aacatcctggtgatccactgccagaccacagacgacctgatccagctgacagccatgtgc
tggctgcgggagttcatccagctggctggccgagtgatgctgccctactcctcagggatc
ctgaccgccgtcctgccctgcctggcctacgacgaccgcaagaggaacatcaaggaggta
gccagtgtctgcaaccagagcctgatgaagctggtcacccccgaggatgacgagcctgac
gagcccaggccagtggtgcagaagcaggcaggccccagccctgaggactgcgcagcaaag
caggagggggcagccagcggagggcctgatggttcttgcgactctagcttcagtagtggc
atcagtgtcttcactccagccagygcggagagggccccggtcaccctccacctggacggg
atcgtgcaggtgctgaactgccacctcagcgacacggccatcggcatgatgaccaggatc
gccgtcctcaagtggctctaccacctgtacatcaagaccccccgcaagatgtcgyggcac
acggacagcctgttccctgtgctcctgcagacgctgtcggacgagtctgacgaggttatc
ctaaaggatctggaggtgctggcagaaattgcttcttcccctgcaggccagacggatgac
ccaggccccctcgatggccctgacctccgggtcagccactcggagctccaggcgcccacc
cccggcagagccggcctgctgaacacacccggtaccaaaggcttggagtgttctccttcc
accccgaccatgaactcctacttttacaagttcatgatcaaccttctcaagaggttcagc
agtgagcggaagctcctggaggtcagaggcgccttcatcatcaggcagctctgcctcctg
ttgcacgcggagagcatcttccactcgatggcggacatcttgctccgggaggaggacctc
acgttcgcctcaaccatggtccacaccctcaacaccatcctgctgacctccactgagctc
ttccagctgcgaaaccagctcaaggacctaaagaccccggagagccggaacctgttctgc
tgcctgtaccgctcctggtgccacaaccccgtcaccacggtgtccctctgcttcctcacc
cagaactaccggcacgcctacgacctcatccagaagttcggggacctggaggtcaccgtg
gatttcctcacggaggtggacaagctggtgcagttgatcgagtgccccatcttcacatac
ctgcgcctgcagctgctggacgtgaagagcaacccgtacctgatcaaggccctgtacggc
ctgctcatgctgctgccgcagagcagcgctttccagctgctgtcacaccgrctgcagtgc
gtgcccaaccctgagctgctgcagaccgaagacggtctgaaggcggcacccaagtcgcag
aaagcagactccccaagcatcgactacgcggagctgctgcagcacttcgagcgggtccag
aagaagcacctggaagtgaggcaccagcggagtgggcgtggggatcacctggaccggagg
gtggtcctctga

DBGET integrated database retrieval system