KEGG   Bos indicus (zebu cattle): 109572638Help
Entry
109572638         CDS       T04792                                 

Gene name
ERCC1
Definition
(RefSeq) DNA excision repair protein ERCC-1
  KO
K10849  DNA excision repair protein ERCC-1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01524  Platinum drug resistance
biu03420  Nucleotide excision repair
biu03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    109572638 (ERCC1)
   03460 Fanconi anemia pathway
    109572638 (ERCC1)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    109572638 (ERCC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:biu03400]
    109572638 (ERCC1)
DNA repair and recombination proteins [BR:biu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     109572638 (ERCC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rad10 HHH_5 HHH_2 HHH
Motif
Other DBs
NCBI-GeneID: 109572638
NCBI-ProteinID: XP_019835153
LinkDB All DBs
Position
18
AA seq 294 aa AA seqDB search
MDEEGVHKPAGPPTRKKFLIPTDEDVVPPPGAKPLFRSTRSLPTVETSPPPGPQTYAEYA
LSGPPGGAEATRPVGPEPLAEETPNQAPKPGAKSNSIIVSPRQRGNPVLRFVRNVPWEFG
DVLPDYVLGQSTCALFLSLRYHNLHPDYIHQRLQSLGKSYALRVLLVQVDVKDPQQALKE
LAKMCILADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKLEQDFVSRVTECLTTVKS
VNKTDSQTLLTTFGSLEQLIAASREDLSLCPGLGPQKARRLFDVFHEPFLKVPH
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggacgaagagggagtacacaagcccgctggcccacccacaaggaagaaattcctcatt
cctacggacgaggatgtggtccctcctcctggggccaagcctttattcagatctactcgg
agcctgcccaccgtagagacctcacccccgccaggccctcagacctacgctgagtatgcc
ctctctggacctccaggcggggctgaagccacgcgcccggtggggccagaacccctggca
gaagagacccccaaccaggcccccaaaccaggagcaaaatccaatagcatcattgtgagc
ccccggcagaggggcaacccggtgctgaggtttgtgcgcaacgtgccctgggagttcggg
gatgtgctacctgactacgtgctgggccagagcacctgtgccctcttcctcagcctccgc
taccacaacctccacccagactacatccaccagcggctgcagagcctggggaagagctac
gccctgcgggtcctgctcgtccaggtggatgtgaaagatcctcagcaggccctcaaggag
ctggctaagatgtgcatcctggccgactgcaccctgatccttgcctggagccccgaggag
gccgggcggtacctggagacatacaaggcctacgagcagaagccggccgatctcctgatg
gagaagctggagcaggacttcgtttcccgggtgactgaatgtctgaccaccgtcaagtca
gtcaacaaaacggacagtcagaccctcctgactacttttgggtctctggaacagctcata
gctgcatcccgggaagatctgtccttgtgcccaggtctgggaccccagaaggcccgaagg
ctgtttgatgtcttccacgagcctttcttgaaagtgccccactga

DBGET integrated database retrieval system