KEGG   Bos indicus (zebu cattle): 109572704
Entry
109572704         CDS       T04792                                 

Gene name
CD37
Definition
(RefSeq) leukocyte antigen CD37
  KO
K06475  CD37 antigen
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109572704 (CD37)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109572704 (CD37)
CD molecules [BR:biu04090]
 Proteins
  109572704 (CD37)
SSDB
Motif
Pfam: Tetraspanin
Other DBs
NCBI-GeneID: 109572704
NCBI-ProteinID: XP_019835287
UniProt: A0A6P5DDW4
LinkDB
Position
18
AA seq 280 aa
MSAHDGCLSLVKYLLFVFNLFFFVLGSLIFCFGIWILIDKTSFVSFVGLSFMPLQIWSKV
LAVSGILTMGLALLGCVGALKEFRCLLGLYFGTLLLLFATQITLGILISTQRVQLKKKVK
DVVQKTIQNYRTHPEETAAEESWDYVQFQLRCCGWESPQDWFHIPSMRRNESEGDRVPCS
CYNSSATNDSTIFDKISPQFSRLGSLAQPRHNVEVCSVPANSYIYQQGCERNLSNWLTNN
LISIVGICLGVGLLELSFMTLSIFLCRNLDHVYDRLARYR
NT seq 843 nt   +upstreamnt  +downstreamnt
atgtcagcccacgatggctgcctcagcctcgtcaagtacctcctcttcgtcttcaacctc
ttcttcttcgtcctaggcagtcttatcttctgcttcggcatctggatactcatcgacaaa
accagcttcgtgtccttcgtgggcttgtccttcatgcccttgcagatctggtccaaggtc
ctggccgtctcaggaatcctcaccatgggtcttgccctcctgggctgtgtgggggccctg
aaggagttccgctgcctcctgggcctgtattttgggacactgctgctcctgtttgccaca
cagatcaccctaggaatcctcatctccactcagagagtccagctgaagaagaaagtgaag
gacgtcgtgcagaagaccatccaaaactaccgcactcatccggaggagacggcggcggag
gagagctgggactacgtgcagtttcagctgcgctgctgtggctgggagtctcctcaggac
tggttccatatccccagcatgagacgcaacgagtccgaaggggaccgcgtgccctgctcc
tgctataactcatcggcgaccaacgactccacaatcttcgataagatctccccccagttt
agccggctcggatcactggcgcagccccgacacaatgtagaagtttgctcggtccccgcg
aacagctacatctaccaacagggctgcgaacggaatctctccaactggttgaccaacaac
ctcatctccatagtgggcatttgtctcggcgtgggtctactcgagctcagcttcatgacg
ctctccatattcctgtgcagaaacctggaccacgtctacgatcggctcgctcggtaccgc
tag

DBGET integrated database retrieval system