KEGG   Bos indicus (zebu cattle): 109572766Help
Entry
109572766         CDS       T04792                                 

Gene name
MARVELD3
Definition
(RefSeq) MARVEL domain-containing protein 3 isoform X1
  KO
K21099  MARVEL domain-containing protein 3
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04530  Tight junction
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109572766 (MARVELD3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:biu02000]
    109572766 (MARVELD3)
Transporters [BR:biu02000]
 Other transporters
  Pores ion channels [TC:1]
   109572766 (MARVELD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MARVEL
Motif
Other DBs
NCBI-GeneID: 109572766
NCBI-ProteinID: XP_019835406
LinkDB All DBs
Position
18
AA seq 383 aa AA seqDB search
MEQTSGTXXXXXXPRERDPDRHPRPEPDRHPERQRDRAGDRHRERNGGGRRDGDRDRERN
RQPRQDRPRAGDHRGGEQRVWENSRQSRTRDGPRRPXLDAAPPPWPATLETPEPPPLRKE
GLGRRGPESEPTSGRYALSNPRPGLQEVVYYQSEAEGLLECHKCRYLCTGRGVIQIVEVI
LNGMVLMCIVASYFVLAGFSASFASGGGFGNNYYSPFEGTELEQVRQLDQQYTILRAPLI
YGGVAVSLGLGVLTLGVLLQGAKSLHKLPGKWLLLEAAFSLLAAVGYCVGISIYLHAALQ
INATDTCRTRERVYARKGLTWMNCQLAGTDGAAATFACLLVVMYGASVVLALRSYREQKQ
YKDSQEQQRNYNDAPEYVWSGVL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggaacagacgtcggggactnnnnnnnnnnnnnnnnggccgagagagcgcgacccagac
cggcatccccgcccggaaccagaccgccaccccgagagacagcgggacagagccggggac
cggcacagggagagaaacgggggcgggcggagggacggggaccgggacagggagaggaac
cggcaacctcgccaggacaggcccagggccggggaccatcgcggcggcgaacaaagagtt
tgggaaaactcccgccagagtcggacgcgggacggaccccggcggcctnccttggacgcg
gccccgcccccctggcccgcgacgttggaaaccccggagccaccgcccctgcggaaggag
ggcctcggacgccgaggacccgaaagtgaacccacttcagggagatacgcactctcgaac
ccccggcctggactacaggaagtggtatattaccagtcagaggctgaagggctcctggaa
tgccacaagtgcagatacctgtgcaccgggagaggtgtgatacagatagtggaggtgata
ctgaatgggatggttctcatgtgtatcgtggcctcctactttgtcctggccggattcagc
gccagctttgccagcggcggcggctttgggaacaactattactcgccatttgagggcacc
gagctggagcaggttcggcagctggaccagcagtacacaatcctccgggcacccctgata
tacggcggcgtggctgtttctctggggctcggtgtcctcaccttgggtgttttactccaa
ggagccaaaagtctacacaaactgccggggaagtggctcctcctggaggctgccttcagc
ctcctggcggcagtgggctactgcgtgggcatcagcatttacctccacgcagccttgcag
atcaatgccacagacacttgcaggacaagagagagggtctatgcccgcaagggtctcacc
tggatgaactgccagcttgcaggcactgatggagcggctgccacctttgcttgtcttctg
gtggtgatgtatggcgccagcgtggtgctggccctgcggagctaccgagaacagaagcag
tacaaggacagccaggaacagcagagaaattacaatgatgcaccagaatacgtgtggtct
ggagtactctga

DBGET integrated database retrieval system