KEGG   Bos indicus (zebu cattle): 109572798Help
Entry
109572798         CDS       T04792                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu03030  DNA replication
biu03410  Base excision repair
biu03420  Nucleotide excision repair
biu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    109572798 (LIG1)
   03410 Base excision repair
    109572798 (LIG1)
   03420 Nucleotide excision repair
    109572798 (LIG1)
   03430 Mismatch repair
    109572798 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:biu03032]
    109572798 (LIG1)
   03400 DNA repair and recombination proteins [BR:biu03400]
    109572798 (LIG1)
Enzymes [BR:biu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     109572798 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     109572798 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     109572798 (LIG1)
DNA replication proteins [BR:biu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    109572798 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     109572798 (LIG1)
DNA repair and recombination proteins [BR:biu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     109572798 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     109572798 (LIG1)
   MMR (mismatch exicision repair)
    Other MMR factors
     109572798 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DNA_ligase_OB_2 PucR DDR
Motif
Other DBs
NCBI-GeneID: 109572798
NCBI-ProteinID: XP_019835463
LinkDB All DBs
Position
18
AA seq 958 aa AA seqDB search
MERLGPQPEGLLVTSPALLCGCRNRKLVTSGEEEWGENSDTIMQRSIMSFFQPKKEGKXK
KPEKETAKSIRETESPPKVALKERNRVVSEGDSPVKRPGRKATRVLGSEGEEEEEEAPTT
PRSQKPASDSPQASPPSPVTLPESSPSHSKPSPAVASPSGIPKRRTARKQLPKRTFQDVL
KEQGEDKDPETKKKKEEEAETPIESLPEPEGDDKEEVEGGDQPTTPPEPRKTSTESPTES
VSEPGVTVKQEPQEDGQAQPPPKTPKTLSSFFSPRKPAVKKEAKEEGPGALRKDEIKGHV
DPASYNPAKNNYHPIEDACWKAGQRVPYLAVARAFEKIEEVSARLRMVETLSNLLRSVVA
LSPADLLPVLYLSLNRLGPPQQGLELGIGEGILLKAVAQATGRQLESVRAEVAEKGDVGL
VAESSRSTQRLVLPPPALTAAGVFAKFRDIAQLAGSASTTKKIDVIKGLFVACRHSEARF
IARALSGRLRLGLAEQSVLAALAQAVSLTPPSQECPPAVVDAGKGKTAEARKTWLEEQGM
ILKQTFCEVPDLERIVPVLLEHGLERLPEHCRLSPGVPLKPMLAHPTRGVSEVLKRFEEA
AFTCEYKYDGQRAQIHVLEGGEVKIFSRNQEDNTGRYPDIISRIPKIKLPSVTSFILDTE
AVAWDREKKQIQPFQVLTTRKRKEVDAAEIQVQVCLYAFDLIYLNGESLVREPLSRRRQL
LRENFVETEGEFVFATSLDTKDTEQIAEFLEQSVKDSCEGLMVKTLDVDATYEIAKRSHN
WLKLKKDYLEGVGDTLDLVVIGAYLGKGKRAGRYGGFLLASYDEESEEFQAICKLGTGFS
DEELEEHHQRLQALVLPTPRSYVRADGAVAPDHWLDPSDVWEVKCADLSLSPIYPAARGL
VDSEKGISLRFPRFIRVREDKKPEQATTSAQVAGLYKKQSQIQNQQGAEPDSEQEEFY
NT seq 2877 nt NT seq  +upstreamnt  +downstreamnt
atggagaggcttggaccgcaacccgaaggactcctggtgaccagtcccgctctactctgc
ggttgcaggaacaggaaactggtgaccagcggagaggaggagtggggagagaattctgat
accatcatgcagcgaagtatcatgtcatttttccagcccaagaaagagggcaaarcgaag
aagccagagaaggagacagccaagagcatcagagaaacagagtcccctccgaaggtggcg
ctgaaggagcggaatcgagtggtgtctgagggtgactctccagtgaagaggccagggagg
aaggcgacccgggtcctgggcagcgagggcgaggaggaggaagaggaagcccccaccacc
cccagaagccagaagcctgcttcagactctccacaggcctcgcctcccagtcctgtcaca
ctgcctgagagcagcccttcccactccaaaccctccccagcagttgcatccccatcaggg
atcccgaagcgtcgcacggcccggaagcagcttcccaaacggacatttcaagatgttctg
aaagagcagggcgaggacaaggatccagaaactaagaagaagaaggaggaagaagcggag
acaccaatagaaagcctcccagagcctgaaggggacgacaaggaggaagtggaaggtggg
gaccagcccacgacgccccctgagccccggaagacctccacagagtccccgacagaaagc
gtctcagagcccggggtgacggtgaagcaggaaccacaggaggatggccaggctcaaccg
ccccccaaaactccaaagaccctcagcagtttcttctccccccggaagccagctgtcaaa
aaagaagcgaaagaagaaggacctggtgctctgagaaaggacgagatcaagggacacgtg
gacccagcgagctataatcctgccaagaacaactatcaccccatcgaagatgcctgctgg
aaggcgggccagagggttccttatctggctgtggcccgggcgttcgagaagatcgaggag
gtctctgctcggctccggatggtggagacgctgagcaacctgctgcgctccgtggtggcc
ctgtcacctgctgacctcctgcccgtcctctacctgagcctcaaccgcctggggccgccc
cagcagggcctggagctcggcatcggagagggcatcctcctcaaggcagtggcccaggcc
acgggtcggcagctggagtccgtccgggccgaggtggccgagaagggtgatgtggggctg
gtggccgagagcagccgcagcacccagaggctcgtgctgcccccgcctgcgctcactgcc
gccggcgtcttcgccaagttccgggacatcgcgcagctggcaggcagcgcttccacaacc
aagaagattgacgtcatcaaaggcctctttgtggcctgccgtcactcagaggcacgtttc
attgccagagccctgagtggacggctgcgcctcgggttggctgagcagtcggtgctggcg
gccctcgcccaggccgtgagcctcacgccccccagtcaagaatgcccccccgccgtggtg
gacgccgggaagggcaagacggcagaagccagaaagacgtggctggaggagcaaggcatg
atcctgaagcagactttctgtgaggtacctgacctggagcggatcgtccccgtgcttctg
gaacacggcctggagcggctcccggagcactgcagactgagcccaggggttcccctgaaa
ccaatgttggcccaccccacccggggtgtcagtgaggtcctgaagcgctttgaggaggca
gctttcacctgcgagtacaaatacgacgggcagagggcacagatccacgttctggaaggc
ggggaggtaaagatcttcagcaggaatcaggaggacaatactggaaggtaccccgacatt
atcagccgcatccctaagattaaactcccatcggtcacatccttcatcctagacacagaa
gctgtagcttgggaccgggaaaagaagcagatccagccattccaagtcctcaccacccgc
aaacgcaaggaggtggacgcggcggagatccaggtgcaggtgtgtctgtatgccttcgat
ctcatctacctcaacggagagtccctggtacgtgagcccctctcccgacgccggcagctg
ctccgggagaacttcgtggagacggagggcgagttcgtctttgccacctccctagacacc
aaggacacggagcagatcgcagagttcttggagcagtcggtgaaagactcctgcgagggg
ctgatggtgaagaccctggacgtggacgccacctacgagatcgccaagaggtcacacaac
tggctcaagctgaagaaggactacctcgagggtgtgggcgacaccctggacctcgtagtg
attggtgcctacctgggcaaggggaaacgggccggccggtacgggggcttcctgctggcc
tcctatgacgaggagagcgaggagttccaggccatctgcaagctcggaactggcttcagt
gacgaggagctggaagagcaccaccagaggctccaggccttagtgctgcccaccccgcgc
tcctacgttcgggctgacggtgcggtggcccccgaccactggctggaccccagcgacgtg
tgggaggtgaagtgcgcggacctctccctgtcccccatctaccctgcggcccgaggcctg
gtggacagcgagaaggggatctccctccgcttccctcggtttattcgcgtccgtgaggat
aagaagccggagcaggccactaccagtgcccaggtggccggtctgtacaagaagcagagt
cagattcagaaccagcagggtgcggagccggactccgagcaggaagagttctactag

DBGET integrated database retrieval system