KEGG   Bos indicus (zebu cattle): 109572897Help
Entry
109572897         CDS       T04792                                 

Gene name
KMT5C
Definition
(RefSeq) histone-lysine N-methyltransferase KMT5C isoform X1
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    109572897 (KMT5C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:biu03036]
    109572897 (KMT5C)
Enzymes [BR:biu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     109572897 (KMT5C)
Chromosome and associated proteins [BR:biu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109572897 (KMT5C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 109572897
NCBI-ProteinID: XP_019835621
LinkDB All DBs
Position
18
AA seq 457 aa AA seqDB search
MGPDRVTARELCENDDLATSLVLDPYLGFRTHKMNVSPVPPLRRQHHLRSALEAFLRQRD
LEAAYRALTLGGWMAHYFQSRGPRQEAALKTHIYRYLRAFLPESGFTILPCTRYSMETNG
AKIVSTRAWKKNEKLELLVGCIAELRXADEELLRAGENDFSIMYSTRKRSAQLWLGPAAF
INHDCKPNCKFVPADGNAACVKVLRDIEPGDEVTCFYGEGFFGEKNEHCECYTCERRGEG
AFRLRPREPLPPRPLDKYELRETKRRLQQGLDGPRSCAHPPPPRRDPFCAACQPLRPPPC
SARLDASPLWLHWLPQPQLRVRPRRRRRLRLQPRQALPPPVLPAARVSLHRWGGCGPHCR
LRAEARVALVQAPRACWAPQQDWHWARRYGLPSVVRVDLSRVVPALPATANPAPSGTPGP
IPVPKQALAFTPFSPPKRLRLVVSHGSIDLDVNSDGP
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggggcccgacagagtaaccgctagagaactgtgtgagaatgacgacctggccaccagc
ctcgtcctggacccctacctcggcttccgcacccacaagatgaacgtcagccccgtgccc
cccctgcgacgacagcaccacctgcgctcagctctggaggccttcctgaggcagcgggac
ctggaggctgcgtaccgggccctgacgctgggaggctggatggcccactacttccagagc
cggggcccacggcaggaagctgccctcaagacccacatctatcgctacctccgcgccttc
ctgcctgaaagtggcttcaccatcttgccctgtacccgttattccatggagacaaatgga
gccaagattgtgtcaactcgcgcatggaaaaagaacgagaagctggagctgctggtgggc
tgcatcgcggagctgcgggrggccgacgaggagctgctgagagccggggagaacgacttc
agcatcatgtactcaacccgcaagcgcagcgctcagctgtggctcggccctgccgccttc
atcaaccacgactgcaaacccaactgcaagtttgtgcctgcagatggaaacgcagcgtgc
gtgaaggtgctccgggacatcgagccaggggacgaggtgacctgtttctacggcgagggc
ttcttcggcgagaagaatgagcactgtgaatgctacacctgtgaaaggagaggggagggc
gctttccgactgcggcccagggagcccctgccgccccgacctctggacaagtacgagctc
cgggagaccaaacggcggttgcagcaaggtctggacgggccccggtcctgtgcccaccca
cccccgccgcgccgggaccccttctgcgccgcctgccagcccctgcgccccccaccctgc
agcgcccgacttgatgcctcacccctctggctccactggctgcctcagccccagctccgg
gtgcgtccccggagacgccgacgcctgcgcctgcagccccggcaagccctgccgcctcca
gttctcccagctgcccgcgtctccctgcaccggtggggaggctgcggcccccactgccgc
ctacgggcggaggcccgggtggccttggttcaggccccccgcgcctgctgggccccccag
caggactggcactgggcccggcgctacgggctgccttctgtggtccgtgtggatctgagc
cgcgtggtgccagccctgcctgccactgccaaccctgccccctctgggaccccaggtccc
atccctgtccccaagcaggcccttgccttcacccccttctccccacccaagcgcctgcgg
ctkgtggtcagccatggctccattgacttggatgtcaacagcgatgggccatga

DBGET integrated database retrieval system