KEGG   Bos indicus (zebu cattle): 109572992
Entry
109572992         CDS       T04792                                 

Gene name
FLT3LG
Definition
(RefSeq) fms-related tyrosine kinase 3 ligand isoform X1
  KO
K05454  fms-related tyrosine kinase 3 ligand
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04014  Ras signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04640  Hematopoietic cell lineage
biu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109572992 (FLT3LG)
   04014 Ras signaling pathway
    109572992 (FLT3LG)
   04151 PI3K-Akt signaling pathway
    109572992 (FLT3LG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109572992 (FLT3LG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109572992 (FLT3LG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109572992 (FLT3LG)
Cytokines and growth factors [BR:biu04052]
 Growth factors
  Growth factors (RTK binding)
   109572992 (FLT3LG)
SSDB
Motif
Pfam: Flt3_lig
Other DBs
NCBI-GeneID: 109572992
NCBI-ProteinID: XP_019835741
UniProt: A0A6P5DBY8
LinkDB
Position
18
AA seq 353 aa
MVVLAPAWSPTTSLLLLLLLLSPGLQGTPDCSFRHSPISSTFAIKIGKLSKYLLQDYPVT
VASNLQDVSHRREGPRMEVGRRNSRFTAPLGARLVCPPGHPLPGDPGVLVPSPLRPPAGP
RAWVVSPQDKLCGAFWRLVLAQRWMGRLKTVAGSEMEKLLEDVNTEIHFVTSCAFQPLPS
CLRFVQANISHLLQDTHQQLEALKPWITHRNFSRCLELQCQPDSPTLLPPRSPGALGATS
LPGPQSPLLLLLLLLLLPVALLLLATAWCLCRWRRRRRTRYPGERRRTLRPRESSHLPAD
TESELGGSQLEPGPFLGHPAPVTVPPGWRQRQHPPSAPPSPLCTKPLSPGNCI
NT seq 1062 nt   +upstreamnt  +downstreamnt
atggtagtgctggcgccagcctggagcccaactacctcccttctgctgctgctgttactg
ctcagccctggcctccaagggacccccgactgctccttccgccacagccccatctcctcc
acctttgccatcaagatcggcaagctgtccaagtacctgcttcaagattacccggtcact
gttgcctccaacctgcaggacgtgagtcacagacgggaggggcccaggatggaggtggga
aggagaaattcaagattcaccgcccccttaggggccaggctagtgtgcccaccaggccac
cccctccctggggacccaggagtcctggtccccagccccctccgcccacccgcgggaccc
agagcctgggtggtctccccccaggacaagctctgcggggcgttctggcgtctggtcctg
gcccagcgctggatgggacggctcaagaccgtggctgggtcggagatggagaaactgctg
gaggatgtcaacaccgagatacactttgtcacctcatgtgccttccagccccttcccagc
tgtcttcgcttcgtccaggccaacatctcccacctcctgcaggacactcaccagcagctg
gaggccttgaagccctggatcacccaccggaatttctcccggtgcctggaactacagtgt
cagccggactccccgactctgctgcccccaaggagtcctggggccttgggagccacgtcc
ctgccgggccctcagtcccctcttctgctcctcttgctgctgctgctgctgccagtggcc
ctcctgctgctggccactgcctggtgcctatgccggtggaggaggagacggaggacacgc
taccctggggagaggcggaggacactgaggcccagagagagcagtcacctgccagcggac
acagagtcggaacttggaggaagtcagctagaacctggtcctttccttggccaccctgct
cctgtcactgtccccccgggatggaggcaacgccagcacccaccatcggctcccccttcc
ccactttgtacaaagcccttgtccccaggaaattgtatataa

DBGET integrated database retrieval system