KEGG   Bos indicus (zebu cattle): 109572998
Entry
109572998         CDS       T04792                                 

Gene name
PRKCG
Definition
(RefSeq) protein kinase C gamma type
  KO
K19663  classical protein kinase C gamma type [EC:2.7.11.13]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu04010  MAPK signaling pathway
biu04012  ErbB signaling pathway
biu04014  Ras signaling pathway
biu04015  Rap1 signaling pathway
biu04020  Calcium signaling pathway
biu04066  HIF-1 signaling pathway
biu04070  Phosphatidylinositol signaling system
biu04071  Sphingolipid signaling pathway
biu04150  mTOR signaling pathway
biu04270  Vascular smooth muscle contraction
biu04310  Wnt signaling pathway
biu04370  VEGF signaling pathway
biu04510  Focal adhesion
biu04540  Gap junction
biu04613  Neutrophil extracellular trap formation
biu04650  Natural killer cell mediated cytotoxicity
biu04666  Fc gamma R-mediated phagocytosis
biu04670  Leukocyte transendothelial migration
biu04713  Circadian entrainment
biu04720  Long-term potentiation
biu04723  Retrograde endocannabinoid signaling
biu04724  Glutamatergic synapse
biu04725  Cholinergic synapse
biu04726  Serotonergic synapse
biu04727  GABAergic synapse
biu04728  Dopaminergic synapse
biu04730  Long-term depression
biu04750  Inflammatory mediator regulation of TRP channels
biu04911  Insulin secretion
biu04916  Melanogenesis
biu04918  Thyroid hormone synthesis
biu04919  Thyroid hormone signaling pathway
biu04921  Oxytocin signaling pathway
biu04925  Aldosterone synthesis and secretion
biu04928  Parathyroid hormone synthesis, secretion and action
biu04929  GnRH secretion
biu04935  Growth hormone synthesis, secretion and action
biu04960  Aldosterone-regulated sodium reabsorption
biu04961  Endocrine and other factor-regulated calcium reabsorption
biu04970  Salivary secretion
biu04971  Gastric acid secretion
biu04972  Pancreatic secretion
biu05017  Spinocerebellar ataxia
biu05022  Pathways of neurodegeneration - multiple diseases
biu05031  Amphetamine addiction
biu05032  Morphine addiction
biu05143  African trypanosomiasis
biu05146  Amoebiasis
biu05161  Hepatitis B
biu05163  Human cytomegalovirus infection
biu05170  Human immunodeficiency virus 1 infection
biu05171  Coronavirus disease - COVID-19
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05206  MicroRNAs in cancer
biu05214  Glioma
biu05223  Non-small cell lung cancer
biu05225  Hepatocellular carcinoma
biu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109572998 (PRKCG)
   04012 ErbB signaling pathway
    109572998 (PRKCG)
   04014 Ras signaling pathway
    109572998 (PRKCG)
   04015 Rap1 signaling pathway
    109572998 (PRKCG)
   04310 Wnt signaling pathway
    109572998 (PRKCG)
   04370 VEGF signaling pathway
    109572998 (PRKCG)
   04066 HIF-1 signaling pathway
    109572998 (PRKCG)
   04020 Calcium signaling pathway
    109572998 (PRKCG)
   04070 Phosphatidylinositol signaling system
    109572998 (PRKCG)
   04071 Sphingolipid signaling pathway
    109572998 (PRKCG)
   04150 mTOR signaling pathway
    109572998 (PRKCG)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109572998 (PRKCG)
   04540 Gap junction
    109572998 (PRKCG)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    109572998 (PRKCG)
   04650 Natural killer cell mediated cytotoxicity
    109572998 (PRKCG)
   04666 Fc gamma R-mediated phagocytosis
    109572998 (PRKCG)
   04670 Leukocyte transendothelial migration
    109572998 (PRKCG)
  09152 Endocrine system
   04911 Insulin secretion
    109572998 (PRKCG)
   04929 GnRH secretion
    109572998 (PRKCG)
   04921 Oxytocin signaling pathway
    109572998 (PRKCG)
   04935 Growth hormone synthesis, secretion and action
    109572998 (PRKCG)
   04918 Thyroid hormone synthesis
    109572998 (PRKCG)
   04919 Thyroid hormone signaling pathway
    109572998 (PRKCG)
   04928 Parathyroid hormone synthesis, secretion and action
    109572998 (PRKCG)
   04916 Melanogenesis
    109572998 (PRKCG)
   04925 Aldosterone synthesis and secretion
    109572998 (PRKCG)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    109572998 (PRKCG)
  09154 Digestive system
   04970 Salivary secretion
    109572998 (PRKCG)
   04971 Gastric acid secretion
    109572998 (PRKCG)
   04972 Pancreatic secretion
    109572998 (PRKCG)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    109572998 (PRKCG)
   04961 Endocrine and other factor-regulated calcium reabsorption
    109572998 (PRKCG)
  09156 Nervous system
   04724 Glutamatergic synapse
    109572998 (PRKCG)
   04727 GABAergic synapse
    109572998 (PRKCG)
   04725 Cholinergic synapse
    109572998 (PRKCG)
   04728 Dopaminergic synapse
    109572998 (PRKCG)
   04726 Serotonergic synapse
    109572998 (PRKCG)
   04720 Long-term potentiation
    109572998 (PRKCG)
   04730 Long-term depression
    109572998 (PRKCG)
   04723 Retrograde endocannabinoid signaling
    109572998 (PRKCG)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109572998 (PRKCG)
  09159 Environmental adaptation
   04713 Circadian entrainment
    109572998 (PRKCG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109572998 (PRKCG)
   05206 MicroRNAs in cancer
    109572998 (PRKCG)
   05205 Proteoglycans in cancer
    109572998 (PRKCG)
   05231 Choline metabolism in cancer
    109572998 (PRKCG)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109572998 (PRKCG)
   05214 Glioma
    109572998 (PRKCG)
   05223 Non-small cell lung cancer
    109572998 (PRKCG)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    109572998 (PRKCG)
   05022 Pathways of neurodegeneration - multiple diseases
    109572998 (PRKCG)
  09165 Substance dependence
   05031 Amphetamine addiction
    109572998 (PRKCG)
   05032 Morphine addiction
    109572998 (PRKCG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109572998 (PRKCG)
   05161 Hepatitis B
    109572998 (PRKCG)
   05171 Coronavirus disease - COVID-19
    109572998 (PRKCG)
   05163 Human cytomegalovirus infection
    109572998 (PRKCG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109572998 (PRKCG)
   05143 African trypanosomiasis
    109572998 (PRKCG)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109572998 (PRKCG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109572998 (PRKCG)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     109572998 (PRKCG)
Protein kinases [BR:biu01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   109572998 (PRKCG)
SSDB
Motif
Pfam: Pkinase C1_1 PK_Tyr_Ser-Thr C2 Pkinase_C Kinase-like
Other DBs
NCBI-GeneID: 109572998
NCBI-ProteinID: XP_019835752
UniProt: A0A6P5DF52
LinkDB
Position
18
AA seq 697 aa
MSGLGPGGGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIG
KQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL
LYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTSDEIHVTVGEA
RNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFNLKPGDVERRL
SVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCNLLQ
KFEACNYPLELYERVRTGPSSSPIPSPSPSPTDSKRCFFGASPGRLHISDFSFLMVLGKG
SFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQL
HSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRD
LKLDNVMLDAEGHIKITDFGMCKENVFPGSTTRTFCGTPDYIAPEIIAYQPYGKSVDWWS
FGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPAKRLGS
GPDGEPTIRAHGFFRWIDWDRLERLEIAPPFRPRPCGRSGENFDKFFTRAAPALTPPDRL
VLASIDQAEFQGFTYVNPDFVHPDARSPISPTPVPVM
NT seq 2094 nt   +upstreamnt  +downstreamnt
atgtccggcctgggccccggcggaggcgattcagagggcggaccccggcccctgttctgc
agaaagggggctctgaggcagaaggtggtccatgaggtcaagagccacaagttcaccgct
cgcttcttcaagcagccgaccttctgcagccactgcactgacttcatatgggggattgga
aaacagggtctgcaatgtcaagtctgcagttttgtggttcatcgacgatgccacgagttt
gtgaccttcgagtgtccaggcgctgggaagggcccccagacggacgatccccggaacaag
cacaagttccgtctgcacagctacagcagccccaccttctgcgaccactgtggctccctg
ctctacgggctggtgcaccagggcatgaagtgttcttgctgcgagatgaacgtgcaccgg
cgctgtgtgcgcagcgtgccctctctgtgcggcgtggaccacacggagcgccggggccgc
ctgcagctggagatccgggcgcccacttccgatgagatccacgttacggttggcgaggcc
cggaacctcatcccaatggaccccaacggtctctccgatccctatgtgaagctgaagctc
atcccagaccctcggaatttgaccaagcagaagacccgcacggtgaaagctacgctaaac
cctgtgtggaacgagacctttgtgttcaacctgaagccgggggacgtggagcgccggctc
agcgtggaggtgtgggactgggaccggacctcccgaaacgacttcatgggcgccatgtcc
ttcggcgtctcggagctgctcaaggcgccggtggacggctggtacaagttactgaaccag
gaggagggcgagtattacaatgtgccggtggctgacgccgacaactgcaacctcctccag
aagttcgaggcctgtaactaccccctggaactatacgagagggtgcggacgggtccstct
tcatctcccatcccctccccatcccccagtcccaccgactccaagcgctgtttcttcggg
gccagccctggacgactgcacatctccgacttcagcttcctcatggttctaggaaaaggc
agttttgggaaggtgatgctggccgagcgccggggctccgatgagctctacgccatcaag
atcctgaagaaagacgtgatcgtccaggatgacgacgtggactgcaccctggtggagaaa
cgcgtgctggctctggggggccgaggcccgggaggccggccgcacttcctcacccagctt
cactccaccttccagaccccggatcgcctgtattttgtgatggagtatgtcaccgggggc
gacttgatgtaccacattcaacagctgggcaagtttaaggaaccccacgcagcgttctac
gctgcagaaatcgccatcggcctcttcttcctccataaccagggcattatctatcgggac
ctgaaactggacaacgtgatgctggatgccgaaggacacatcaaaatcaccgacttcggc
atgtgtaaggagaacgtctttcccgggagtaccactcgcaccttctgcgggaccccggac
tacatagcccccgagatcattgcctaccaaccctatgggaagtctgtggattggtggtcc
tttggggttctgctctacgagatgttggcaggacagcccccctttgatggagaagatgag
gaggagctgtttcaagccatcatggaacaaactgtcacctaccccaagtcgctttcccgg
gaagctgtggccatctgcaaggggttcctcaccaagcacccggccaagcgcctgggctca
ggccccgatggagagcctaccatccgcgctcacggctttttccgctggatcgactgggac
aggctggaacgattagagatcgcgcctccgttcagaccccgcccgtgtggccgcagcggc
gagaacttcgacaagttcttcactcgggcggcgccggcgctgacaccccctgaccgcctg
gttctggccagcatcgaccaggctgagttccagggcttcacctatgtcaacccggatttc
gtgcacccggatgcccgcagccccatcagcccaacgcctgtgccagtcatgtaa

KEGG   Bos indicus (zebu cattle): 109573366
Entry
109573366         CDS       T04792                                 

Gene name
PRKCA
Definition
(RefSeq) protein kinase C alpha type
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu04010  MAPK signaling pathway
biu04012  ErbB signaling pathway
biu04014  Ras signaling pathway
biu04015  Rap1 signaling pathway
biu04020  Calcium signaling pathway
biu04066  HIF-1 signaling pathway
biu04070  Phosphatidylinositol signaling system
biu04071  Sphingolipid signaling pathway
biu04072  Phospholipase D signaling pathway
biu04150  mTOR signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04261  Adrenergic signaling in cardiomyocytes
biu04270  Vascular smooth muscle contraction
biu04310  Wnt signaling pathway
biu04360  Axon guidance
biu04370  VEGF signaling pathway
biu04510  Focal adhesion
biu04540  Gap junction
biu04613  Neutrophil extracellular trap formation
biu04650  Natural killer cell mediated cytotoxicity
biu04664  Fc epsilon RI signaling pathway
biu04666  Fc gamma R-mediated phagocytosis
biu04670  Leukocyte transendothelial migration
biu04713  Circadian entrainment
biu04720  Long-term potentiation
biu04723  Retrograde endocannabinoid signaling
biu04724  Glutamatergic synapse
biu04725  Cholinergic synapse
biu04726  Serotonergic synapse
biu04727  GABAergic synapse
biu04728  Dopaminergic synapse
biu04730  Long-term depression
biu04750  Inflammatory mediator regulation of TRP channels
biu04911  Insulin secretion
biu04912  GnRH signaling pathway
biu04916  Melanogenesis
biu04918  Thyroid hormone synthesis
biu04919  Thyroid hormone signaling pathway
biu04921  Oxytocin signaling pathway
biu04925  Aldosterone synthesis and secretion
biu04926  Relaxin signaling pathway
biu04928  Parathyroid hormone synthesis, secretion and action
biu04929  GnRH secretion
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu04935  Growth hormone synthesis, secretion and action
biu04960  Aldosterone-regulated sodium reabsorption
biu04961  Endocrine and other factor-regulated calcium reabsorption
biu04970  Salivary secretion
biu04971  Gastric acid secretion
biu04972  Pancreatic secretion
biu05017  Spinocerebellar ataxia
biu05022  Pathways of neurodegeneration - multiple diseases
biu05031  Amphetamine addiction
biu05032  Morphine addiction
biu05143  African trypanosomiasis
biu05146  Amoebiasis
biu05161  Hepatitis B
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05170  Human immunodeficiency virus 1 infection
biu05171  Coronavirus disease - COVID-19
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05206  MicroRNAs in cancer
biu05214  Glioma
biu05223  Non-small cell lung cancer
biu05225  Hepatocellular carcinoma
biu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109573366 (PRKCA)
   04012 ErbB signaling pathway
    109573366 (PRKCA)
   04014 Ras signaling pathway
    109573366 (PRKCA)
   04015 Rap1 signaling pathway
    109573366 (PRKCA)
   04310 Wnt signaling pathway
    109573366 (PRKCA)
   04370 VEGF signaling pathway
    109573366 (PRKCA)
   04066 HIF-1 signaling pathway
    109573366 (PRKCA)
   04020 Calcium signaling pathway
    109573366 (PRKCA)
   04070 Phosphatidylinositol signaling system
    109573366 (PRKCA)
   04072 Phospholipase D signaling pathway
    109573366 (PRKCA)
   04071 Sphingolipid signaling pathway
    109573366 (PRKCA)
   04151 PI3K-Akt signaling pathway
    109573366 (PRKCA)
   04150 mTOR signaling pathway
    109573366 (PRKCA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109573366 (PRKCA)
   04540 Gap junction
    109573366 (PRKCA)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    109573366 (PRKCA)
   04650 Natural killer cell mediated cytotoxicity
    109573366 (PRKCA)
   04664 Fc epsilon RI signaling pathway
    109573366 (PRKCA)
   04666 Fc gamma R-mediated phagocytosis
    109573366 (PRKCA)
   04670 Leukocyte transendothelial migration
    109573366 (PRKCA)
  09152 Endocrine system
   04911 Insulin secretion
    109573366 (PRKCA)
   04929 GnRH secretion
    109573366 (PRKCA)
   04912 GnRH signaling pathway
    109573366 (PRKCA)
   04921 Oxytocin signaling pathway
    109573366 (PRKCA)
   04926 Relaxin signaling pathway
    109573366 (PRKCA)
   04935 Growth hormone synthesis, secretion and action
    109573366 (PRKCA)
   04918 Thyroid hormone synthesis
    109573366 (PRKCA)
   04919 Thyroid hormone signaling pathway
    109573366 (PRKCA)
   04928 Parathyroid hormone synthesis, secretion and action
    109573366 (PRKCA)
   04916 Melanogenesis
    109573366 (PRKCA)
   04925 Aldosterone synthesis and secretion
    109573366 (PRKCA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109573366 (PRKCA)
   04270 Vascular smooth muscle contraction
    109573366 (PRKCA)
  09154 Digestive system
   04970 Salivary secretion
    109573366 (PRKCA)
   04971 Gastric acid secretion
    109573366 (PRKCA)
   04972 Pancreatic secretion
    109573366 (PRKCA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    109573366 (PRKCA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    109573366 (PRKCA)
  09156 Nervous system
   04724 Glutamatergic synapse
    109573366 (PRKCA)
   04727 GABAergic synapse
    109573366 (PRKCA)
   04725 Cholinergic synapse
    109573366 (PRKCA)
   04728 Dopaminergic synapse
    109573366 (PRKCA)
   04726 Serotonergic synapse
    109573366 (PRKCA)
   04720 Long-term potentiation
    109573366 (PRKCA)
   04730 Long-term depression
    109573366 (PRKCA)
   04723 Retrograde endocannabinoid signaling
    109573366 (PRKCA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109573366 (PRKCA)
  09158 Development and regeneration
   04360 Axon guidance
    109573366 (PRKCA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    109573366 (PRKCA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109573366 (PRKCA)
   05206 MicroRNAs in cancer
    109573366 (PRKCA)
   05205 Proteoglycans in cancer
    109573366 (PRKCA)
   05231 Choline metabolism in cancer
    109573366 (PRKCA)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109573366 (PRKCA)
   05214 Glioma
    109573366 (PRKCA)
   05223 Non-small cell lung cancer
    109573366 (PRKCA)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    109573366 (PRKCA)
   05022 Pathways of neurodegeneration - multiple diseases
    109573366 (PRKCA)
  09165 Substance dependence
   05031 Amphetamine addiction
    109573366 (PRKCA)
   05032 Morphine addiction
    109573366 (PRKCA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109573366 (PRKCA)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109573366 (PRKCA)
   05161 Hepatitis B
    109573366 (PRKCA)
   05171 Coronavirus disease - COVID-19
    109573366 (PRKCA)
   05164 Influenza A
    109573366 (PRKCA)
   05163 Human cytomegalovirus infection
    109573366 (PRKCA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109573366 (PRKCA)
   05143 African trypanosomiasis
    109573366 (PRKCA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109573366 (PRKCA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109573366 (PRKCA)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109573366 (PRKCA)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     109573366 (PRKCA)
Protein kinases [BR:biu01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   109573366 (PRKCA)
Membrane trafficking [BR:biu04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    109573366 (PRKCA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 APH
Other DBs
NCBI-GeneID: 109573366
NCBI-ProteinID: XP_019836087
UniProt: A0A6P5DG17
LinkDB
Position
19
AA seq 672 aa
NVRAARKGALRQKNVHEVKNHRFIARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHK
RCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCDTCD
MNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVTDEKLHVTVRDAKNLIPMDPNGLSDPYV
KLKLIPDPKNESKQKTKTIRSTLNPRWDESFTFKLKPSDKDRRLSVEIWDWDRTTRNDFM
GSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNVELRQKFEKAKLGPAGNK
VISPSEDRRQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKGTEELYAIKILKKDVVI
QDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFK
EPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIADFGMCKEHMMDGVTTR
TFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVS
YPKSLSKEAVSICKGLMTKHPGKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKP
KVTFCTKTHWLQWASRPSCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVN
PQFVHPILQSAV
NT seq 2019 nt   +upstreamnt  +downstreamnt
aatgtgcgggctgcccgcaaaggggcgctgaggcagaagaacgtgcacgaggtgaagaac
caccgcttcatcgcgcgcttcttcaagcagcccaccttctgcagccactgcaccgacttc
atctgggggtttgggaaacaaggcttccagtgccaagtttgctgttttgtggttcacaag
aggtgccatgaatttgttactttttcttgtccgggggcggataaaggaccygacacagat
gacccgaggagcaagcacaagttcaagatccacacgtatggcagccccaccttctgtgat
cactgcggctccctgctctacggactcatccaccaggggatgaaatgtgacacctgtgat
atgaacgtgcacaagcagtgcgtgatcaacgtgcccagcctctgcgggatggaccacacg
gagaagaggggccgcatctacctgaaggccgaggtcacggatgaaaagctgcacgtcaca
gtacgagatgcgaaaaacctaatccctatggatccaaatgggctttcagatccttacgtg
aagctgaagcttattcctgaccccaagaacgagagcaaacagaaaaccaagaccatccgc
tcgacgctgaacccccggtgggacgagtccttcacgttcaaattaaaaccttctgataaa
gaccggcgactgtccgtggaaatctgggactgggatcgaaccacacggaacgacttcatg
gggtccctttcctttggggtctcggagctgatgaagatgccggccagcggatggtacaag
ctgctgaaccaagaggagggcgagtactacaacgtgccgatccccgaaggcgacgaggaa
ggcaacgtggagctcaggcagaaattcgagaaagccaagcttggccctgccggcaacaaa
gtcatcagtccctccgaggacaggagacagccttccaacaacctggacagagtgaagctc
acggacttcaacttcctcatggtgctgggcaaaggcagctttgggaaggtgatgctggcc
gaccggaaggggacagaggagctgtacgccatcaagatcctgaagaaggacgtggtcatc
caggacgacgacgtggagtgcaccatggtggagaagcgggtcctggcgctgctcgacaag
ccgccgttcctgacgcagctgcactcctgcttccagacggtggaccggctgtactttgtc
atggagtacgtcaacggcggggacctcatgtaccacatccagcaggtcgggaagttcaag
gagccgcaagcagtgttctatgcagcagagatttccatcgggctgttctttcttcataaa
agaggaatcatttatcgggacctgaagttagacaacgtcatgctggactcggaaggacac
attaagatcgcggacttcgggatgtgcaaggagcacatgatggacggcgtcacgaccagg
accttctgcgggacccctgactacatcgccccagagataatcgcctatcagccgtacggg
aagtccgtggactggtgggcctacggcgtcctgttgtacgagatgttggccgggcagcct
ccgttcgacggcgaggacgaggacgagctgttccagtccatcatggagcacaacgtctcg
taccccaagtccttgtccaaggaggccgtgtccatctgcaaagggctgatgaccaagcac
cccgggaagcggctgggctgcgggcccgagggcgagcgcgacgtgcgggagcatgccttc
ttccggaggatcgactgggagaagctggagaaccgtgagatccagccacccttcaagccc
aaagtgactttctgcaccaaaacgcactggcttcagtgggcgtccaggccttcgtgcggc
aaaggagcagagaactttgacaagttcttcacgcgagggcagcctgtcttgacgccgccc
gaccagctggtcatcgctaacatcgaccagtctgattttgaaggcttctcctacgtcaac
ccccagttcgtgcaccccatcctgcagagcgcggtatga

KEGG   Bos indicus (zebu cattle): 109578560
Entry
109578560         CDS       T04792                                 

Gene name
PRKCB
Definition
(RefSeq) protein kinase C beta type isoform X1
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu04010  MAPK signaling pathway
biu04012  ErbB signaling pathway
biu04014  Ras signaling pathway
biu04015  Rap1 signaling pathway
biu04020  Calcium signaling pathway
biu04062  Chemokine signaling pathway
biu04064  NF-kappa B signaling pathway
biu04066  HIF-1 signaling pathway
biu04070  Phosphatidylinositol signaling system
biu04071  Sphingolipid signaling pathway
biu04150  mTOR signaling pathway
biu04270  Vascular smooth muscle contraction
biu04310  Wnt signaling pathway
biu04370  VEGF signaling pathway
biu04510  Focal adhesion
biu04540  Gap junction
biu04613  Neutrophil extracellular trap formation
biu04650  Natural killer cell mediated cytotoxicity
biu04662  B cell receptor signaling pathway
biu04666  Fc gamma R-mediated phagocytosis
biu04670  Leukocyte transendothelial migration
biu04713  Circadian entrainment
biu04720  Long-term potentiation
biu04723  Retrograde endocannabinoid signaling
biu04724  Glutamatergic synapse
biu04725  Cholinergic synapse
biu04726  Serotonergic synapse
biu04727  GABAergic synapse
biu04728  Dopaminergic synapse
biu04730  Long-term depression
biu04750  Inflammatory mediator regulation of TRP channels
biu04911  Insulin secretion
biu04912  GnRH signaling pathway
biu04916  Melanogenesis
biu04918  Thyroid hormone synthesis
biu04919  Thyroid hormone signaling pathway
biu04921  Oxytocin signaling pathway
biu04925  Aldosterone synthesis and secretion
biu04928  Parathyroid hormone synthesis, secretion and action
biu04929  GnRH secretion
biu04931  Insulin resistance
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu04935  Growth hormone synthesis, secretion and action
biu04960  Aldosterone-regulated sodium reabsorption
biu04961  Endocrine and other factor-regulated calcium reabsorption
biu04970  Salivary secretion
biu04971  Gastric acid secretion
biu04972  Pancreatic secretion
biu04973  Carbohydrate digestion and absorption
biu05017  Spinocerebellar ataxia
biu05022  Pathways of neurodegeneration - multiple diseases
biu05031  Amphetamine addiction
biu05032  Morphine addiction
biu05140  Leishmaniasis
biu05143  African trypanosomiasis
biu05146  Amoebiasis
biu05161  Hepatitis B
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05170  Human immunodeficiency virus 1 infection
biu05171  Coronavirus disease - COVID-19
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05206  MicroRNAs in cancer
biu05214  Glioma
biu05223  Non-small cell lung cancer
biu05225  Hepatocellular carcinoma
biu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109578560 (PRKCB)
   04012 ErbB signaling pathway
    109578560 (PRKCB)
   04014 Ras signaling pathway
    109578560 (PRKCB)
   04015 Rap1 signaling pathway
    109578560 (PRKCB)
   04310 Wnt signaling pathway
    109578560 (PRKCB)
   04370 VEGF signaling pathway
    109578560 (PRKCB)
   04064 NF-kappa B signaling pathway
    109578560 (PRKCB)
   04066 HIF-1 signaling pathway
    109578560 (PRKCB)
   04020 Calcium signaling pathway
    109578560 (PRKCB)
   04070 Phosphatidylinositol signaling system
    109578560 (PRKCB)
   04071 Sphingolipid signaling pathway
    109578560 (PRKCB)
   04150 mTOR signaling pathway
    109578560 (PRKCB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109578560 (PRKCB)
   04540 Gap junction
    109578560 (PRKCB)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    109578560 (PRKCB)
   04650 Natural killer cell mediated cytotoxicity
    109578560 (PRKCB)
   04662 B cell receptor signaling pathway
    109578560 (PRKCB)
   04666 Fc gamma R-mediated phagocytosis
    109578560 (PRKCB)
   04670 Leukocyte transendothelial migration
    109578560 (PRKCB)
   04062 Chemokine signaling pathway
    109578560 (PRKCB)
  09152 Endocrine system
   04911 Insulin secretion
    109578560 (PRKCB)
   04929 GnRH secretion
    109578560 (PRKCB)
   04912 GnRH signaling pathway
    109578560 (PRKCB)
   04921 Oxytocin signaling pathway
    109578560 (PRKCB)
   04935 Growth hormone synthesis, secretion and action
    109578560 (PRKCB)
   04918 Thyroid hormone synthesis
    109578560 (PRKCB)
   04919 Thyroid hormone signaling pathway
    109578560 (PRKCB)
   04928 Parathyroid hormone synthesis, secretion and action
    109578560 (PRKCB)
   04916 Melanogenesis
    109578560 (PRKCB)
   04925 Aldosterone synthesis and secretion
    109578560 (PRKCB)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    109578560 (PRKCB)
  09154 Digestive system
   04970 Salivary secretion
    109578560 (PRKCB)
   04971 Gastric acid secretion
    109578560 (PRKCB)
   04972 Pancreatic secretion
    109578560 (PRKCB)
   04973 Carbohydrate digestion and absorption
    109578560 (PRKCB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    109578560 (PRKCB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    109578560 (PRKCB)
  09156 Nervous system
   04724 Glutamatergic synapse
    109578560 (PRKCB)
   04727 GABAergic synapse
    109578560 (PRKCB)
   04725 Cholinergic synapse
    109578560 (PRKCB)
   04728 Dopaminergic synapse
    109578560 (PRKCB)
   04726 Serotonergic synapse
    109578560 (PRKCB)
   04720 Long-term potentiation
    109578560 (PRKCB)
   04730 Long-term depression
    109578560 (PRKCB)
   04723 Retrograde endocannabinoid signaling
    109578560 (PRKCB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109578560 (PRKCB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    109578560 (PRKCB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109578560 (PRKCB)
   05206 MicroRNAs in cancer
    109578560 (PRKCB)
   05205 Proteoglycans in cancer
    109578560 (PRKCB)
   05231 Choline metabolism in cancer
    109578560 (PRKCB)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109578560 (PRKCB)
   05214 Glioma
    109578560 (PRKCB)
   05223 Non-small cell lung cancer
    109578560 (PRKCB)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    109578560 (PRKCB)
   05022 Pathways of neurodegeneration - multiple diseases
    109578560 (PRKCB)
  09165 Substance dependence
   05031 Amphetamine addiction
    109578560 (PRKCB)
   05032 Morphine addiction
    109578560 (PRKCB)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    109578560 (PRKCB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109578560 (PRKCB)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109578560 (PRKCB)
   05161 Hepatitis B
    109578560 (PRKCB)
   05171 Coronavirus disease - COVID-19
    109578560 (PRKCB)
   05164 Influenza A
    109578560 (PRKCB)
   05163 Human cytomegalovirus infection
    109578560 (PRKCB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109578560 (PRKCB)
   05140 Leishmaniasis
    109578560 (PRKCB)
   05143 African trypanosomiasis
    109578560 (PRKCB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109578560 (PRKCB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109578560 (PRKCB)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     109578560 (PRKCB)
Protein kinases [BR:biu01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   109578560 (PRKCB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 Kinase-like CEP76-C2 APH
Other DBs
NCBI-GeneID: 109578560
NCBI-ProteinID: XP_019843452
UniProt: A0A6P5E2L5
LinkDB
Position
25
AA seq 673 aa
MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS
LLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIEREVLIVVVRDA
KNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRL
SVEIWDWDLTSRNDFMGSLSFGISELQKAGVDGWFKLLSQEEGEYFNVPVPPEGSEGNEE
LRQKFERAKIGPGPKTPEEKTTNTISKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSE
RKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVM
EYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHI
KIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAP
FEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFF
RYIDWEKLERKEIQPPYKPKACGRNAENFDRFFTRHPPVLTPPDQEVIRNIDQSEFEGFS
FVNSEFLKPEVKS
NT seq 2022 nt   +upstreamnt  +downstreamnt
atggctgacccggccgcggggccgccgccgagcgagggagaggagagcaccgtgcgcttc
gcccgcaaaggcgccctccggcagaagaacgtgcacgaggtgaagaaccacaaattcacc
gcccgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctggggcttc
gggaagcaaggatttcagtgccaagtctgctgttttgtcgtgcacaagcggtgccatgaa
tttgtcaccttctcctgyccgggcgctgacaagggcccagcctctgacgacccccggagc
aaacacaagttcaagatccacacatactccagccccacgttttgtgaccactgygggtca
ttgctctatggacttatccaccaggggatgaaatgtgacacctgcatgatgaacgtccac
aagcgctgcgtgatgaacgtccccagcctctgcggcacggaccacacggagcgccgcggc
cgcatctacatccaagcccacatcgagagggaggtcctcattgttgtcgtaagagatgct
aaaaaccttgtacctatggatcctaatggcttgtcagatccttacgtgaaactgaaactg
attcctgatcccaagagtgagagcaagcagaagaccaagaccatcaagtgctccctcaac
cctgagtggaacgaaacatttagattccagctgaaagaatcggacaaagacaggagactg
tctgtagagatttgggattgggatctgaccagcagaaatgacttcatgggatctttgtcg
tttgggatttctgaactgcagaaagctggtgttgatggctggtttaagttactgagccag
gaggaaggcgagtacttcaacgtgcccgtgccaccggaaggcagtgagggcaacgaggaa
ctgcgacagaaattcgagagagccaagatcggtcctgggcccaagactcctgaagaaaag
acgaccaacaccatctccaaatttgacaacaacggcaacagggaccggatgaaattgacc
gattttaacttcctgatggtgctgggaaaaggcagctttggcaaggtcatgctctcagag
cgaaaaggcacagatgagctgtatgctgtgaagatcctgaaaaaggacgtggtcatccaa
gatgatgacgtggaatgcacgatggtggagaagcgggtgctggccctgcccgggaagccg
cccttcctgacccagctgcattcctgcttccagaccatggatcgcctgtacttcgtgatg
gagtatgtgaayggcggtgacctcatgtaccacatccagcaagtgggccggttcaaggag
cctcacgccgtattttacgctgcagaaattgccatcggtctgttcttcttgcagagcaag
ggcatcatttaccgtgacctgaaacttgacaatgtgatgctggattcygagggccacatc
aagatcgctgattttggcatgtgtaaggagaacatctgggatggggtgacgactaagacc
ttctgcggcaccccagactacatcgcccccgagataattgcttatcagccctatgggaag
tccgtggattggtgggcatttggcgtcctgctgtatgagatgttggctgggcaggcaccg
tttgaaggggaggacgaggatgaactcttccagtccatcatggaacacaacgtggcttat
ccgaagtccatgtccaaggaagctgtggccatctgcaaagggctgatgaccaaacaccca
ggcaaacgtctgggttgtggacctgaaggtgaacgtgacatcaaagagcatgcatttttc
cggtatattgactgggagaaacttgaacgcaaagagattcagcccccatataagccgaaa
gcctgtgggcgaaatgctgaaaacttcgaccgatttttcacccgccatccaccagttcta
acacctcctgaccaggaagtcatcaggaatattgaccaatcagaattcgaaggattttcc
tttgttaactctgaatttttaaaacctgaagtcaagagctaa

DBGET integrated database retrieval system