KEGG   Bos indicus (zebu cattle): 109573322Help
Entry
109573322         CDS       T04792                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04614  Renin-angiotensin system
biu04924  Renin secretion
biu05142  Chagas disease (American trypanosomiasis)
biu05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    109573322
   04614 Renin-angiotensin system
    109573322
 09160 Human Diseases
  09166 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    109573322
  09174 Infectious diseases: Parasitic
   05142 Chagas disease (American trypanosomiasis)
    109573322
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:biu01002]
    109573322
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109573322
   04090 CD molecules [BR:biu04090]
    109573322
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     109573322
Peptidases [BR:biu01002]
 Metallo Peptidases
  Family M2
   109573322
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109573322
CD molecules [BR:biu04090]
 Proteins
  109573322
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 DUF4131 DUF1634
Motif
Other DBs
NCBI-GeneID: 109573322
NCBI-ProteinID: XP_019836042
LinkDB All DBs
Position
19
AA seq 751 aa AA seqDB search
MELDRDWATASSGSAVXLVMGTRWTCPGPSLLVLFCCAXAQGDQDSDQLYNETVAKAFLE
FYERTAQVVWNQFMAAAWNYVTNITKKNQEEMLYKDVEKSQHTLYFGTRARMFKIANFQD
SDVKRMLSKLLNVDKAALPKEELREYNEILAYMETTYSMAQVCLNEGPCLPLEPDLEEVM
ATSRDQKELLWAWQGWRDAVGRQLRMTFERYVQLSNKAANLNGYQDMGALWRSKYESDTL
QEDLEQLFQELQPLYLNLHAYVRRALYRFYGPELIDLRGPIPAHILGNMWAQSWVNILDL
ALPFPEKPPEDITKIMQGQHWKPEKMFQEAEKFFTSMGLLSTPPEFWKNSMMERPTDGRE
VECHASAWDFYNGKDFRIKKCTEVTIEDLLSIFHQMGHIQYFLQYKNLSVIFRAGANPAF
EEAMGSVVTLSASSHKHLLNRGLLSQQHQDKEEEVNFLMSVALEKIAFIPFAYLMDLFRW
KVFDGTIEKDVYNQEWWNLRLKYQGLCPPIPRTEEDFDPGAKFHISASLPYIRYFLSLVL
QFQFHEALCKASGHMGPLHRCDIYNSKEAGKLLEDVLKLGSSKPWPEVLEKMTGETKVST
KALMTYFKPLLNWLVTENVRQGEILGWPDFSCSFEERETSRAAFLGMELNSDQVKSWQWT
LLALSFVMLLAVLLLGXRLYTMEKSSLTQDTTSKTCFLGIAMEPHQVVKRQWMLLGLCLL
LMLCSIGLIIWIFTQHNRKPPWMRDEWGSWD
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atggagctggaccgtgattgggccacagcctcctccggctctgctgttcktttggtcatg
ggaacaagatggacttgccctggcccttccctcctygtgctcttctgttgtgccrtggct
cagggtgaccaggactcagaccagctctacaatgagactgtggcaaaggccttcctggag
ttttacgagcgaacagcccaggttgtatggaaccagttcatggcggccgcctggaactat
gtcaccaacatcacaaagaaaaatcaagaggagatgctgtacaaggacgtggagaagtcc
cagcacacactgtactttggcacgcgggcccgcatgtttaagatcgccaacttccaggac
tcggacgtgaagcgcatgctgagtaagctgctgaacgtagacaaggcggccctgcccaag
gaggagctccgggagtacaacgagattctggcctacatggagaccacgtacagcatggcc
caggtctgcctgaatgaggggccctgcctgcccctggagcctgacctcgaagaagtcatg
gccacctcccgagaccagaaggagctgctgtgggcctggcagggctggcgggacgccgtg
ggtcgccagctccgcatgacctttgagcgctacgtgcagctcagcaacaaggctgcgaat
ctcaatggttaccaagacatgggggccttgtggaggtccaagtacgagtccgacacgctg
caggaagacctggagcagctgttccaggagctgcagccgctctacctgaacctgcatgcc
tacgtgcgcagggccctctaccgcttctatgggcccgagctcatcgacctgagggggccc
atccccgcccacatcctggggaacatgtgggctcagtcctgggtcaacatcttagacctg
gccctgcccttcccggagaagcccccygaggacatcacgaagatcatgcaaggccagcac
tggaagcctgagaaaatgttccaagaggctgaaaaattcttcacctccatggggctgctt
tccacccctcctgagttctggaaaaactccatgatggaaaggccaactgacgggcgggag
gtggagtgccacgcgtccgcctgggacttctacaacgggaaggacttcaggataaagaag
tgcaccgaagtgaccatagaagacctgctgtccatcttccaccagatgggccacatccag
tacttcctgcaatacaagaacctctcggtgatcttccgcgcaggcgccaacccagccttc
gaggaggccatggggtcggtggtcaccctttcagcctcttcccacaagcacctgctcaac
agaggcctgctcagccaacagcaccaggacaaagaggaggaggtcaatttcctgatgagc
gttgccctggagaagatcgccttcatccccttcgcctacctgatggacctgtttcgctgg
aaggtctttgacggcaccatcgagaaggatgtgtacaaccaggagtggtggaacctcagg
ttgaagtaccagggcctgtgccctcccatccctcggacagaggaggactttgatccaggc
gccaagttccacatctctgccagcttgccctacatacggtactttctcagcctcgtgctc
caattccagttccatgaagcactctgcaaggcctcgggccacatggggccgctgcaccgc
tgtgacatctataactccaaggaggcygggaagctcctggaggatgtcctgaagctgggc
tcgagcaagccctggccagaggtcctggagaagatgaccggggagaccaaggtgtctaca
aaggccctcatgacctacttcaagcccctgctgaactggctggtcactgagaacgtgcgg
cagggggagatactgggctggccagacttcagctgttcctttgaagaaagagaaacaagc
agggcagcattcctggggatggagctgaactctgaccaggtcaaatcctggcagtggacg
ttgctggccctgagctttgtcatgttactggcagtcctgctgctgggccrcaggctgtac
accatggaaaaaagctcactgacccaagacaccacatcgaaaacctgctttctgggcata
gcgatggagccccaccaagttgtcaagagacagtggatgctgctgggcctctgcctcctc
ctgatgctgtgctccattggcctcatcatttggattttcacacagcacaacaggaagcct
ccgtggatgagagatgaatgggggagctgggactag

DBGET integrated database retrieval system