KEGG   Bos indicus (zebu cattle): 109573417
Entry
109573417         CDS       T04792                                 

Gene name
CSF3
Definition
(RefSeq) granulocyte colony-stimulating factor isoform X1
  KO
K05423  granulocyte colony-stimulating factor
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04630  JAK-STAT signaling pathway
biu04640  Hematopoietic cell lineage
biu04657  IL-17 signaling pathway
biu05144  Malaria
biu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109573417 (CSF3)
   04151 PI3K-Akt signaling pathway
    109573417 (CSF3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109573417 (CSF3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109573417 (CSF3)
   04657 IL-17 signaling pathway
    109573417 (CSF3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    109573417 (CSF3)
  09174 Infectious disease: parasitic
   05144 Malaria
    109573417 (CSF3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109573417 (CSF3)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  CSF and other factors
   109573417 (CSF3)
SSDB
Motif
Pfam: GCSF IL11
Other DBs
NCBI-GeneID: 109573417
NCBI-ProteinID: XP_019836194
UniProt: A0A6P5DF10
LinkDB
Position
19
AA seq 230 aa
MKLMGECLGPGRGELRQQRAGVPGLPERSALLLSPHLLSVLQLLLWHSALWTVHEATPLG
PARSLPQSFLLKCLEQVRKIQADGAELQERLCAAHKLCHPEELMLLRHSLGIPQAPLSSC
SSQSLQLTSCLNQLHGGLFLYQGLLQALAGISPELAPTLDTLQLDVTDFATNIWLQMEDL
GAAPAVQPTQGAMPTFTSAFQRRAGGVLVASQLHRFLELAYRGLRYLAEP
NT seq 693 nt   +upstreamnt  +downstreamnt
atgaagctgatgggtgagtgtctgggtcctgggaggggagagctgcggcagcagcgggca
ggggtgcctgggcttccagaaaggtctgcacttctcctgagcccccatctgctctcagtc
ctgcagctgctcctctggcacagtgcgctctggacggtgcacgaagccaccccccttggc
cctgcccgatccctgccccagagcttcctgctcaagtgyttagagcaagtgaggaaaatc
caggctgatggcgccgagctgcaggagaggctgtgtgccgcccacaagctgtgccacccg
gaggagctgatgctgctcaggcactctctgggcatcccccaggctcccctaagcagctgc
tccagccagtccctgcagctgacgagctgcctgaaccaactacacggcggcctctttctc
taccagggcctcctgcaggccctggcgggcatctccccagagctggcccccaccttggac
acactgcagctggacgtcactgactttgccacgaacatctggctgcagatggaggacctg
ggggcggcccccgctgtgcagcccacccagggcgccatgccgaccttcacttcagccttc
caacgcagagcaggaggggtcctggttgcttcccagctgcatcgtttcctggagctggca
taccgtggcctgcgctaccttgctgagccctga

DBGET integrated database retrieval system