KEGG   Bos indicus (zebu cattle): 109573698
Entry
109573698         CDS       T04792                                 

Gene name
BRCA1
Definition
(RefSeq) breast cancer type 1 susceptibility protein isoform X1
  KO
K10605  breast cancer type 1 susceptibility protein [EC:2.3.2.27]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01524  Platinum drug resistance
biu03440  Homologous recombination
biu03460  Fanconi anemia pathway
biu04120  Ubiquitin mediated proteolysis
biu04151  PI3K-Akt signaling pathway
biu05206  MicroRNAs in cancer
biu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    109573698 (BRCA1)
  09124 Replication and repair
   03440 Homologous recombination
    109573698 (BRCA1)
   03460 Fanconi anemia pathway
    109573698 (BRCA1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    109573698 (BRCA1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    109573698 (BRCA1)
  09162 Cancer: specific types
   05224 Breast cancer
    109573698 (BRCA1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    109573698 (BRCA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:biu01009]
    109573698 (BRCA1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:biu04121]
    109573698 (BRCA1)
   03036 Chromosome and associated proteins [BR:biu03036]
    109573698 (BRCA1)
   03400 DNA repair and recombination proteins [BR:biu03400]
    109573698 (BRCA1)
Enzymes [BR:biu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     109573698 (BRCA1)
Protein phosphatases and associated proteins [BR:biu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109573698 (BRCA1)
Ubiquitin system [BR:biu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    109573698 (BRCA1)
  Multi subunit Ring-finger type E3
   BRCC complex
    109573698 (BRCA1)
Chromosome and associated proteins [BR:biu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     109573698 (BRCA1)
DNA repair and recombination proteins [BR:biu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA1-core complex
     109573698 (BRCA1)
    BRCA1-A complex
     109573698 (BRCA1)
    BRCA1-B complex
     109573698 (BRCA1)
    BRCA1-C complex
     109573698 (BRCA1)
    BRCA complex
     109573698 (BRCA1)
   FA (Fanconi anemia) pathway
    Downstream FA components
     109573698 (BRCA1)
SSDB
Motif
Pfam: BRCT_assoc BRCT zf-C3HC4 zf-C3HC4_2 zf-C3HC4_4 zf-C3HC4_3 zf-RING_UBOX zf-RING_2 zf-RING_5 zf-Nse BRCT_2 zf-RING_6 zf-ANAPC11 zf-RING_10 Prok-RING_4 zf-rbx1
Other DBs
NCBI-GeneID: 109573698
NCBI-ProteinID: XP_019836612
UniProt: A0A6P5DHF8
LinkDB
Position
19
AA seq 1849 aa
MDLSADHVEEVQNVLNAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQ
CPLCKNDITKRSLQESTRFSQLVEELLKIIHAFELDTGLQFANSYNFSRKEDNSPEHLKE
EVSIIQSMGYRNRAKRLWQSEPENPTLQETSLTVELSNLGIVRSLRTKQQTQSQNKSVYI
ELGSDSSEDTVNKASYFSVGDHELLEITPQGAKAKTNLNPAEKAACEFSEKDITNTEHHQ
LSIKDLITTQKHATETHPEKYQGISVSDFHVEPCGTDTHASSLQHENSSLLLTENRLNVE
KAEFCNKSKQPVLVKSQQSRWAESKXTCKDRQIPSTEKKIVLNTDPLYRRKELRKQKPAC
PDSPGDSQDVPWVTLNNSIQKVNDWFSRSDEILTSDDSCDGGSESNNEVAGAVEIPNKVD
GYSGSSEKINLMASDPHGTLIHERVHSKPVESNIEDKIFGKTYRRKSSLPNFSHIAEDLI
LGAFTVEPQITQEQPLTNKLKCKRRGTSGLQPEDFIKKVDLTIVPKTPEKMTEGTDQTEQ
KCHGMNITSDGHENKTKRDYVQKEQNANPAESLEKESVFRTEAEPISISISNMELELNIH
RSKAPKNRLKRKSSTRKIPELELVVSRNPSLPNHTELPIDSSSSNEEMKKKHSSQMPVRQ
SQKLQLIGDKELTAGAKNNKTYEQINKRLASDAFPXLKLTNTPGYFTNCSSKPEEFVHPS
LQREENLGTIQVSNSTKDPKDLILREGKALQIERSVESTNISLVPDTDYSTQDSISLLEA
KTPEKAKTAPNPCVSLCTATKNLKELIHRDFKDTKNNTEGFQDLLGHDINYVIQETSREM
EDSELDTQYLQNTFKASKRQTFALFSNPGNPQKECATVFAHSGSLRDQSPRDPLKCRQKE
DSQGKSESKSQHVQAICTTVHFPVADQQDRTPGDDAKCSAKEVTRVCQSSQLRGHKTELV
FANKQGVSEKPNLIPSLSPIKSSVKTVCKKSPSEKFEEPVTSPEKTLGSESIIQSAVSTI
SQNNIQESTFKEVSSNSVNEVGSSTNEVGSSVNEVGSSGENIQAEPGRNREPKLRALLGL
GLTQPEVYKQSLPVSNCHHPEIKRQGENEDMPQAVKADFSPCLISDNLEQPTGSRHASQV
CSETPDNLLNDDEIKENSHFAESDIKERSAVFSESVQKGEFRGSPGPFTHTHLAQGHQRG
AGKLESEETVSSEDEELPCFQQLLFGKVTSTLSPSTGCNTVATEGLSKETEENLESLKSG
LNDCSGQVTSAKVSQEHHLNEEARCSGSLFSSQCSAMEDLTTNTNTQDPFLMFERPSKQV
YQSESEEVLSDKELVSDDEERETGLEEDSCQEEQSVDSDLGEAVSDHVSETSLSEDGVGL
SSQSDILTTQQRDTMQDNLLKLQQEMAELEAVLERHGSQPSHSSASLXADSRGPEHLLNL
EQDTSERAILTSEKSRDYSRSQNPESLSADKFPVSLDSSTNKNKEPGMERSSASKFQLSD
NRWYMHSSRSLQDRNCPSQKEPINVADMEEQQLAKREAQDLMGSFLPRQDQEGTPYLKSG
ISLFSHEPESDPSEDRAAEPAHVHSMPPSASALKLSQFRVEESTKNPAAAHIANTTRCNL
REESMSKEKPEVISSTERSKKRLSMVASGLTPKELMLVQKFARKHHVTLTNLITEETTHV
IMKTDPEFVCERTLKYFLGIAGGKWVVSYFWVTQSIKERKMLDEHDFEVRGDVVNGRNHQ
GPKRARESRDKKIFKGLEICCYGPFTNMPTDQLEWMVQLCGASVVKEPSSFTPDQGTHPV
VVVQPDAWTEDAGFHVIXQMCEAPVVTREWVLDSVALYQCQELDTYLVP
NT seq 5550 nt   +upstreamnt  +downstreamnt
atggatttatctgcggatcatgttgaagaagtacaaaatgtcctcaatgctatgcagaaa
atcttagagtgtccaatatgtctggagttgatcaaagagcctgtctctacaaagtgtgac
cacatattttgcaaattttgtatgctgaaacttctcaaccagaagaaagggccttcacaa
tgtcctttgtgtaagaatgatataaccaaaagaagcctacaagaaagtacaagatttagt
caacttgttgaagagctgttgaagatcattcatgcttttgagcttgacacaggattgcag
tttgcaaacagctataacttttcgagaaaggaagataactctcctgagcatctgaaggag
gaagtttctataatccaaagtatgggctaccggaaccgggccaaaagactttggcagagt
gaacctgaaaatcctaccttgcaggaaaccagtcttactgtcgaactctctaaccttgga
attgtcagatctctgaggacaaagcagcagacacaatctcagaataagtccgtctacatt
gaattgggatctgattcttctgaagacacagttaataaggccagttatttcagtgtggga
gaccatgaattgttagaaatcacccctcaaggagccaaggccaagaccaatttgaatcct
gcagaaaaggctgcttgtgagttttctgagaaggacataacaaatactgaacatcatcaa
ctcagtattaaagatctgatcaccacccagaagcatgcaactgagacgcatccagaaaag
tatcagggtatttctgtttcagactttcacgtggagccatgtggcacagatactcatgcc
agctcattacagcatgagaacagcagtttattgctcactgaaaacagactgaatgtagaa
aaggctgaattctgtaataaaagcaaacagcctgtcttagtaaagagccagcagagcaga
tgggctgaaagtaagrgcacatgtaaggataggcagattcccagcactgagaaaaagata
gttctgaatactgatcccctgtacagaagaaaagaactgcgtaagcagaaacctgcatgc
cctgacagtcctggagattcccaagatgttccttgggtaaccctgaataatagcatacag
aaagttaatgactggttttccagaagtgatgaaatattaacttctgatgactcgtgcgat
ggggggtctgaatcaaataatgaagtagctggtgcagtggaaattccaaataaagttgat
ggatattcaggttcttcagagaaaatcaacttaatggccagtgatcctcatggtacttta
atacacgaaagagtccactccaaacccgtagagagtaatattgaagataaaatatttggg
aaaacctatcggaggaagtcaagtctccctaacttcagccacatagctgaagatctaatt
ctaggcgcatttactgtagaacctcagataacacaagagcagcccctcacaaataaacta
aaatgtaaaaggagaggtacatcaggccttcagcctgaggattttatcaagaaagtcgat
ttgacaattgttccaaagactcctgaaaagatgacggagggaactgaccaaacagagcag
aaatgtcatgggatgaatattactagtgatggtcatgagaataaaacaaaacgtgattat
gttcagaaagagcaaaacgctaacccagcagaatcattggaaaaagaatctgttttcaga
actgaggctgaacctataagcatcagtataagcaatatggaactagaattgaatatccac
cgttcaaaagcacctaagaataggctgaagagaaagtcctctaccaggaaaattcctgaa
cttgaactagtagtcagtagaaacccaagtctacctaatcatactgagctaccaattgat
agcagttctagcaatgaagagatgaagaaaaaacattctagccaaatgccagtcaggcag
agccaaaagcttcaactcattggagataaagaacttactgctggagccaagaataacaaa
acatatgaacaaataaataaaagacttgctagtgatgcttttccagractaaagttaaca
aacacacctggttattttactaactgttctagtaaacctgaagagtttgttcatcctagc
cttcaaagagaggagaacctaggaacaattcaagtgtcgaatagtaccaaagaccccaaa
gatctgatattaagagaaggaaaagctttgcaaattgaaagatctgtagagagtaccaat
atttccttggttcctgatactgattatagcactcaggatagtatctcattactagaagct
aaaaccccagaaaaggcaaagactgcaccaaatccatgtgtgagtctgtgtacagcaacc
aaaaacctcaaggaacttatccatagggattttaaagataccaaaaacaacacagagggc
tttcaggatctactgggacatgacattaactacgtcattcaggagacaagcagagaaatg
gaagacagtgaacttgatacacagtatttgcagaatacattcaaggcttcaaagcgtcag
acatttgctctgttttccaatccaggaaatccacaaaaggaatgtgccacagtctttgcc
cactcggggtccttaagggatcaaagtccaagagaccccctcaaatgcagacaaaaagaa
gacagtcagggaaagagtgagtctaaaagccagcacgtgcaggccatttgtacaacagtg
cactttcctgtggctgatcagcaagataggacgccaggtgacgatgccaaatgtagygca
aaagaagtaactagggtttgtcagtcatcacagttgagaggccacaaaactgaactygtt
tttgcaaataaacaaggggtttcagaaaaaccaaatcttataccatcactttctcccatc
aagtcatctgttaaaaccgtatgtaagaaaagcccatcagagaagtttgaggaacctgta
acgtcacctgaaaaaacattggggagtgagagcatcattcaaagtgcagtgagcacaatc
agccaaaataacattcaagaaagcacttttaaagaagtcagctcaaacagtgtaaatgaa
gtaggttccagtactaatgaagtaggctctagtgttaatgaagtaggttccagtggtgaa
aacattcaagcagaaccaggtagaaacagagaacctaaattaagagctttactcggatta
ggtcttacgcaacctgaagtctataagcaaagtcttcctgtaagtaactgtcaccatcct
gaaataaaaaggcaaggagaaaatgaggacatgcctcaggctgttaaggcagatttctcc
ccatgtctaatttcagataacctcgaacaacctacgggaagccgtcatgcttctcaggtt
tgttctgagacacctgacaacttgttaaatgatgatgaaataaaagaaaatagccacttt
gctgaaagtgacattaaggaaagatctgctgtttttagtgaaagtgtccaaaaaggagaa
ttcagagggagccctggccctttcacccatacacatttggctcagggtcaccaaagaggg
gctggcaaactagagtcagaagagactgtgtctagtgaggatgaagagcttccctgcttc
caacaattattgtttggtaaagtaaccagtacactgtctccatctaccggatgtaacact
gttgccactgagggtctgtctaaggaaacagaggagaacctagaatcattgaagagtggc
ttaaatgactgcagtggccaggtaacatcagccaaggtgtcccaggaacatcaccttaat
gaggaagcgagatgttctggtagcttattttcctcacagtgcagtgcaatggaagacttg
accactaatacaaacacccaggatcctttcttgatgtttgagcgtccttccaaacaagtg
tatcagtctgaaagcgaggaagttctgagtgacaaggaattggtttcagatgatgaagaa
agggaaactggcttggaagaagatagttgccaagaagagcagagtgtggattcagactta
ggtgaagcagtatccgaccatgtgagtgaaacaagcctctctgaagacggtgtggggctg
tcctctcagagcgatatcttaaccactcagcagagggataccatgcaagataacctacta
aagctccagcaggaaatggccgagctggaagctgtgttagagcggcacgggagccagcct
tcccacagctctgcttccctcasagctgattctcgtggcccagagcacctgctaaatcta
gagcaagacacatcagaaagagcaatattaacttcagagaaaagtagagactattctaga
agccagaatcctgaaagcctctctgctgacaagtttccagtatctctggatagttctacc
aataaaaataaagaaccaggaatggaaaggtcttccgcttctaaattccagttgtcggat
aataggtggtatatgcacagctcaaggagtcttcaggacagaaactgcccatctcaaaag
gagcccattaatgttgctgacatggaagagcaacagctggctaagcgtgaggcccaagat
ttaatggggtcttttttgccgagacaagatcaagagggaaccccttatctgaaatctgga
atcagcctcttctctcatgaacccgagtctgatccctctgaagacagagccgcagagcca
gctcatgttcacagcatgccaccctcagcctctgcactgaaattatcccaatttcgagta
gaagaatctaccaagaatccagctgctgctcacattgctaatactacacgttgtaacctg
agggaagaaagtatgagcaaagagaagccagaagtgatatcttcaacagaaagaagcaag
aaaagactttctatggtggcatcaggcttgaccccaaaagaacttatgcttgtgcagaaa
tttgccagaaaacatcacgtcactttaactaatctaattactgaagagactactcatgtc
attatgaaaacagatcctgagtttgtgtgtgaacggacactgaaatatttcctgggaatt
gcaggaggaaaatgggtagttagctatttttgggtcacccagtctattaaagaaagaaag
atgctggatgagcatgattttgaagtcagaggagatgttgtcaatggaagaaaccatcaa
ggcccaaagcgagcaagagaatcccgggacaagaagatcttcaagggcctagaaatctgt
tgctatggaccttttaccaatatgcccacagatcaactagagtggatggtgcagctgtgt
ggggcttctgtggtgaaggagccctcatcattcaccccagaccagggtacccacccagtt
gtggtcgtgcagccggatgcctggacagaggatgctggcttccatgtgatcrggcagatg
tgtgaagcacccgtggtaacccgagagtgggtactggacagtgtggccctctaccagtgc
caggagctggacacctatctggtcccctag

DBGET integrated database retrieval system