KEGG   Bos indicus (zebu cattle): 109573773
Entry
109573773         CDS       T04792                                 

Gene name
STAT5B
Definition
(RefSeq) signal transducer and activator of transcription 5B isoform X1
  KO
K11224  signal transducer and activator of transcription 5B
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04012  ErbB signaling pathway
biu04062  Chemokine signaling pathway
biu04217  Necroptosis
biu04630  JAK-STAT signaling pathway
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu04917  Prolactin signaling pathway
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu04935  Growth hormone synthesis, secretion and action
biu05161  Hepatitis B
biu05162  Measles
biu05166  Human T-cell leukemia virus 1 infection
biu05200  Pathways in cancer
biu05203  Viral carcinogenesis
biu05220  Chronic myeloid leukemia
biu05221  Acute myeloid leukemia
biu05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109573773 (STAT5B)
   04630 JAK-STAT signaling pathway
    109573773 (STAT5B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109573773 (STAT5B)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    109573773 (STAT5B)
   04659 Th17 cell differentiation
    109573773 (STAT5B)
   04062 Chemokine signaling pathway
    109573773 (STAT5B)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    109573773 (STAT5B)
   04935 Growth hormone synthesis, secretion and action
    109573773 (STAT5B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109573773 (STAT5B)
   05203 Viral carcinogenesis
    109573773 (STAT5B)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    109573773 (STAT5B)
   05220 Chronic myeloid leukemia
    109573773 (STAT5B)
   05223 Non-small cell lung cancer
    109573773 (STAT5B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109573773 (STAT5B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109573773 (STAT5B)
   05161 Hepatitis B
    109573773 (STAT5B)
   05162 Measles
    109573773 (STAT5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109573773 (STAT5B)
Transcription factors [BR:biu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    109573773 (STAT5B)
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Other DBs
NCBI-GeneID: 109573773
NCBI-ProteinID: XP_019836757
UniProt: A0A6P5DGH3
LinkDB
Position
19
AA seq 787 aa
MAVWIQAQQLQGDALHQMQALYGQHFPIEVRHYLSQWIESQAWDSIDLDNPQENIKATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGTSPAGSLADAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFAQLAQLNPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRSDRRGAESVTEEKFTILFESQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNS
SSSHLEDYNGMSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRL
GDLSYLIYVFPDRPKDEVYSKYYTPVPCEPATAKAVDGYVKPQIKQVVPEFVSASADSAG
GSATYMDQAPSPAVCPQPHYNMYPQNPDPVLDNDGDFDLDDTIDVARRVEELLGRPMDSQ
WIPHAQS
NT seq 2364 nt   +upstreamnt  +downstreamnt
atggctgtgtggatacaagcccagcagctccaaggagatgcccttcatcagatgcaagcr
ctgtacggycagcatttccccattgaggtgcgccattacttatcccagtggattgaaagc
caagcttgggactcaatagatcttgataatccacaggagaacattaaggccacccagctc
ctggagggcctggtgcaggagttgcagaagaaggcagagcaccaagtgggggaagacggg
ttcctactgaagatcaagctggggcactacgccacacagctccagaacacatatgaccgc
tgccccatggagctggtgcgctgcatccgccatattytgtacaatgaacagaggctggtc
cgagaagccaacaatggtacttctccggctggaagtctcgccgatgccatgtcccagaaa
caccttcaaatcaaccagacatttgaggagctgcgactggtcacacaagacacagagaat
gagctgaagaagctgcagcagactcaagagtactttatcatccagtatcaggagagcctg
aggatccaggctcagtttgcccagctggcccagctgaacccccaggagcgactgagccgg
gagacggccctccagcagaagcaggtgtccctggaggcctggctgcagcgcgaggcccag
acgctgcagcagtaccgcgtggagctggccgaaaagcaccagaagaccctgcagctgctg
cggaagcagcagaccatcatcctggatgacgagctgatccagtggaagcggcggcagcag
ctggcggggaacggagggccccccgagggcagcctggatgtgctacagtcctggtgtgag
aagttggcggagatcatctggcagaaccggcagcagatccgcagagccgagcacctctgc
cagcagctgcccatccccggccccgtggaggagatgctggctgaggtcaacgccaccatc
actgacatcatctcagccctggtgaccagcaccttcatcatcgagaagcagccccctcag
gtcctgaagacccagaccaagttcgcggccaccgtgcgcctgctggtgggcgggaagctg
aacgtgcacatgaaccccccccaggtgaaggccaccatcatcagcgagcagcaggccaag
tcactgctcaagaacgagaacacccgcaatgattacagtggggagatcctgaacaactgc
tgtgtaatggagtaccaccaggccacaggcaccctgagcgcccacttccggaacatgtcc
ctgaaacgaattaagagatctgaccggcgtggagcagagtcggtgacagaagaaaaattt
accatcctgtttgaatcacagttcagtgttggcggaaatgagctggtgtttcaagtcaag
accctgtctctcccagtggtggtgattgttcacggcagccaggataacaatgcgacggcc
accgttctctgggacaacgcttttgcagagcctggcagggtgccgtttgcagtgcccgac
aaagtcctgtggccgcagctgtgcgaggcgctcaacatgaaattcaaggccgaggtgcag
agcaaccggggcctgaccaaggagaacctggtgttcctggcgcagaagctgttcaacagc
agcagcagccatctcgaggactacaacggcatgtccgtgtcctggtcccagttcaaccgg
gagaatttacccggacggaattacactttctggcagtggtttgatggtgttatggaagtg
ttaaagaaacatctcaagcctcattggaatgacggggctatcttgggtttcgtgaacaag
caacaggcccacgacctgcttatcaacaagccagacgggaccttcctgctgaggttcagt
gactctgaaatcggtggcatcaccattgcttggaagtttgattctcaggaaagaatgttt
tggaatctgatgccttttaccaccagagatttctccatccggtccctggccgaccgcttg
ggagacctgagttaccttatctacgtgtttcctgaccggcccaaagacgaagtgtactcc
aagtattacaccccagttccatgcgagcctgccactgctaaagcagtggacggrtacgtg
aagccacagatcaagcargtggtccctgagtttgtgagcgcctctgcagactctgccggm
ggcagtgccacctacatggaccaggctccctccccagccgtgtgcccccagcctcactat
aacatgtacccacagaaccccgaccccgtccttgacaacgatggtgacttcgatctggac
gacacgattgacgtggcgcggcgtgtggaggagctcctaggccgacccatggacagtcag
tggatcccccacgcacagtcgtga

KEGG   Bos indicus (zebu cattle): 109574089
Entry
109574089         CDS       T04792                                 

Definition
(RefSeq) signal transducer and activator of transcription 5A-like
  KO
K11223  signal transducer and activator of transcription 5A
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04012  ErbB signaling pathway
biu04217  Necroptosis
biu04630  JAK-STAT signaling pathway
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu04917  Prolactin signaling pathway
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu04935  Growth hormone synthesis, secretion and action
biu05161  Hepatitis B
biu05162  Measles
biu05166  Human T-cell leukemia virus 1 infection
biu05200  Pathways in cancer
biu05203  Viral carcinogenesis
biu05220  Chronic myeloid leukemia
biu05221  Acute myeloid leukemia
biu05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109574089
   04630 JAK-STAT signaling pathway
    109574089
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109574089
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    109574089
   04659 Th17 cell differentiation
    109574089
  09152 Endocrine system
   04917 Prolactin signaling pathway
    109574089
   04935 Growth hormone synthesis, secretion and action
    109574089
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109574089
   05203 Viral carcinogenesis
    109574089
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    109574089
   05220 Chronic myeloid leukemia
    109574089
   05223 Non-small cell lung cancer
    109574089
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109574089
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109574089
   05161 Hepatitis B
    109574089
   05162 Measles
    109574089
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109574089
Transcription factors [BR:biu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    109574089
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Other DBs
NCBI-GeneID: 109574089
NCBI-ProteinID: XP_019837399
UniProt: A0A6P5DI68
LinkDB
Position
19
AA seq 808 aa
MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRAQATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGSSSAGILVDAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFAQLAQLNPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRADRRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNS
SSSHLEDYNGMSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPDRNLWNLKPFTTRDFSIRSLADRL
GDLNYLIYVFPDRPKDEVFSKYYTPVLGASAHPRAPPPTPPTWTRLLPQPCAPSLTITCT
HRTLTRCSTRMENSTWTRPWMWPGTWKNSSAAQWTVWSPLSPRPLVSLPPAEARCPECLF
EHCTPLWKQSXVCRVLFIVILYLYLCAY
NT seq 2427 nt   +upstreamnt  +downstreamnt
atggcgggctggatccaggcccagcagctgcagggagatgccctgcgccagatgcaggtg
ctatacgggcagcacttccccatcgaggtccggcattacttggcacagtggattgagagc
cagccgtgggatgccatcgacctggacaatccccaggaccgagcccaggccacccagctc
ctggagggcctggtgcaggagttgcagaagaaggcagagcaccaagtcggggaagacggg
ttccttctgaagatcaagctggggcactatgccacgcagctccagaacacgtacgaccgc
tgccccatggagctggtgcgctgcattcgccatattctgtacaatgaacagaggctggtc
cgagaagccaacaatggtagttcttctgctgggatcctggttgatgccatgtcccagaaa
caccttcagatcaaccagacrtttgaggaactgcgactggtcacgcaggacacagagaat
gagctgaagaagctgcagcagactcaagagtatttcatcatccagtatcaggagagcctg
aggatccaggctcagtttgcccagctggcccagctgaacccccaggagcgactgagccgg
gagacggccctccagcagaagcaggtgtccctggaggcctggctgcagcgcgaggcccag
acgctgcagcagtaccgcgtggagctggccgagaagcaccagaagaccctgcagctgctg
cggaagcagcagaccatcatyctggatgacgagctgatccagtggaagcggcggcagcag
ctggcggggaacggagggccccccgagggcagcctggatgtgctacagtcctggtgtgag
aagttggcggagatyatctggcagaaccggcagcagatccgcagagccgagcacctctgc
cagcagctgcccatccccggccccgtggaggagatgctggctgaggtcaacgccaccatc
actgacatcatctcagccctggtgaccagcaccttcatcatcgagaagcagccccctcag
gtcctgaagacccagaccaagttcgcggccaccgtgcgcctgctggtgggcgggaagctg
aacgtgcacatgaaccccccccaggtgaaggccaccatcatcagcgagcagcaggccaag
tcactgctcaagaacgagaacacccgcaatgagtgcagcggggagatcctgaacaactgc
tgtgtgatggagtatcaccaggccacaggcaccctcagcgcccacttcagaaacatgtcc
ctcaagaggatcaagcgagctgaccggcgaggtgcagagtctgtgacggaagagaagttc
acggtcctgtttgagtctcaattcagtgttggcagcaatgagcttgtgttccaggtgaag
accctgtcccttcccgtggttgtcatcgttcatggcagccaggaccacaatgctactgcc
acggtgctgtgggacaatgcctttgctgagccgggcagggtgccgtttgcggtgcccgac
aaagtcttgtggccgcagctgtgcgaggcgctcaacatgaaattcaaggccgaggtgcag
agcaaccggggcctgaccaaggagaacctggtgttcctggcgcagaagctgttcaacagc
agcagcagccatctcgaggactacaacggcatgtccgtgtcctggtcccagttcaaccgg
gagaacttgcccggctggaactacaccttctggcagtggttcgacggggtcatggaggtg
ctgaagaaacatcacaagccccattggaatgacggggccatcctaggttttgtgaacaag
caacaggcccatgacctgctcatcaacaagcccgacggtaccttcttgttgcgcttcagc
gactcagaaattgggggcatcaccatcgcctggaagtttgactctcctgaccgtaacctg
tggaatctgaagccattcaccacgcgggatttctccatccgatccctggccgacaggttg
ggggacctgaactatctcatctacgtgtttcccgaccggcccaaggatgaggtcttctcc
aagtactatactcctgtgcttggtgcgtctgcccacccccgagcccctcccccaacgcca
cctacatggaccaggctccttccccagccgtgtgcccccagcctcactataacatgtacc
cacagaaccctgacccggtgctcgaccaggatggagaattcgacctggacgagaccatgg
atgtggcccggcacgtggaagaactcctccgccgcccaatggacagtctggagccctctc
tccccccgcccactggtctctttacccccggcagaggctcgctgtcctgaatgtttgttc
gaacactgcactcctctgtggaaacaatccycagtgtgcagggtcctattcattgtgatt
ttgtatttgtatctctgtgcatactga

DBGET integrated database retrieval system