KEGG   Bos indicus (zebu cattle): 109573817
Entry
109573817         CDS       T04792                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X1
  KO
K04692  signal transducer and activator of transcription 3
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu04062  Chemokine signaling pathway
biu04066  HIF-1 signaling pathway
biu04068  FoxO signaling pathway
biu04217  Necroptosis
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04630  JAK-STAT signaling pathway
biu04659  Th17 cell differentiation
biu04917  Prolactin signaling pathway
biu04920  Adipocytokine signaling pathway
biu04931  Insulin resistance
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu04935  Growth hormone synthesis, secretion and action
biu05145  Toxoplasmosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05169  Epstein-Barr virus infection
biu05200  Pathways in cancer
biu05203  Viral carcinogenesis
biu05205  Proteoglycans in cancer
biu05206  MicroRNAs in cancer
biu05212  Pancreatic cancer
biu05221  Acute myeloid leukemia
biu05223  Non-small cell lung cancer
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
biu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109573817 (STAT3)
   04066 HIF-1 signaling pathway
    109573817 (STAT3)
   04068 FoxO signaling pathway
    109573817 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109573817 (STAT3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109573817 (STAT3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    109573817 (STAT3)
   04062 Chemokine signaling pathway
    109573817 (STAT3)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109573817 (STAT3)
   04917 Prolactin signaling pathway
    109573817 (STAT3)
   04935 Growth hormone synthesis, secretion and action
    109573817 (STAT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109573817 (STAT3)
   05206 MicroRNAs in cancer
    109573817 (STAT3)
   05205 Proteoglycans in cancer
    109573817 (STAT3)
   05203 Viral carcinogenesis
    109573817 (STAT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109573817 (STAT3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    109573817 (STAT3)
   05221 Acute myeloid leukemia
    109573817 (STAT3)
   05223 Non-small cell lung cancer
    109573817 (STAT3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    109573817 (STAT3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    109573817 (STAT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109573817 (STAT3)
  09172 Infectious disease: viral
   05162 Measles
    109573817 (STAT3)
   05161 Hepatitis B
    109573817 (STAT3)
   05160 Hepatitis C
    109573817 (STAT3)
   05163 Human cytomegalovirus infection
    109573817 (STAT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109573817 (STAT3)
   05169 Epstein-Barr virus infection
    109573817 (STAT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109573817 (STAT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109573817 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109573817 (STAT3)
Transcription factors [BR:biu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    109573817 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 E2R135 DUF4795 Syntaxin-6_N AP1AR Fib_alpha
Other DBs
NCBI-GeneID: 109573817
NCBI-ProteinID: XP_019836841
LinkDB
Position
19
AA seq 770 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEDAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSN
TIDLPMSPRTLDSLMQFGNNGEAAEPSAGGQFESLTFDMELTSECATSPM
NT seq 2313 nt   +upstreamnt  +downstreamnt
atggcccaatggaatcagctccagcagctggacacacggtacttggagcagctccatcag
ctgtacagtgacagcttccccatggagctgcggcagtttctggccccttggattgagagt
caagattgggcatacgcggccagcaaagaatcacatgcgactttggtgtttcataatctc
ttgggagaaattgaccaacagtatagccgcttcctgcaagagtccaatgttctctatcag
cacaatttgcgaagaatcaagcagttccttcagagyagataccttgagaagccaatggag
attgcccgaattgtggcccgttgcctgtgggaagagtcccgcctcctccaaactgcagcc
actgcagcccagcaagggggccaggccaaccaccccacagccgccgtggtaacggagaag
cagcagatgctggagcagcacctgcaggacgtccgcaagcgtgtccaggatctagaacag
aagatgaaagtggtagagaatctccaggatgatttcgatttcaactataaaactctcaag
agtcaaggagacatgcaagatctgaatggaaacaaccagtcggtgaccaggcagaagatg
cagcagctcgaacagatgcttactgccctggaccagatgcggcgcagcatcgtgagtgag
ctggcggggcttttgtcagcratggagtatgtgcagaaaactctcacggatgaagaattg
gctgactggaagaggcgacaacagattgcttgcattggaggccctcccaacatctgccta
gatcggctagaaaactggataacctcattagcagaatctcagcttcagacccgccaacaa
attaagaaactggaggagctgcagcagaaggttagctacaaaggggaccccattgtacag
caccggccaatgctggaggagagaatcgtggagctgtttagaaacttaatgaaaagtgcc
ttcgtrgtrgagcggcagccctgcatgcctatgcatcctgaccggccattagtcatcaag
accggtgtccagttcacaactaaagtcagattgctggttaaattccctgagctaaattat
caacttaagattaaagtgtgcattgacaaagactccggggacgttgcagctctcagaggg
tcccggaaatttaacattctgggcacaaacacgaaagtgatgaacatggaagagtctaac
aatggcagcctctcagcggagttcaaacacttgaccctgagagagcagagatgcggtaat
gggggccgagccaattgtgatgcctccctgattgtgaccgaggagctgcacctgatcacc
tttgagactgaggtgtatcaccaaggcctcaagattgacctggagacccactccttgcca
gtggtggtgatctccaacatctgtcagatgcccaatgcctgggcgtccatcctatggtac
aacatgctgaccaacaaccccaagaacgtgaactttttcaccaaacccccgatcggaacg
tgggatcaagtggccgaggtgctgagctggcagttctcctctaccaccaagcgcgggctg
agcatcgagcagttgacgacgctggcggagaaactcttaggacctggtgtgaactattca
gggtgtcagatcacatgggctaaattttgcaaagaaaacatggctggcaagggcttctcc
ttctgggtctggctggacaacatcattgacctggtgaaaaagtacatcctggccctttgg
aacgaagggtatataatgggcttcatcagcaaggagagggaacgggccatcttgagcact
aagcccccaggtaccttcctgctgagattcagtgaaagcagcaaagaaggaggcgtcacc
ttcacctgggtggagaaggacatcagcggcaagacccagatccagtcagtggaaccttac
accaagcagcagctgaacaacatgtcatttgctgaaataatcatgggctataagatcatg
gatgccaccaatatcctggtgtctccactggtctatctctaccccgacattccaaaggag
gacgcgttcggaaagtactgtcggccrgagagccaggagcatcctgaagccgacccaggt
agtgctgccccgtacctgaagaccaagttcatctgtgtgacaccaacgacctgcagcaat
accattgacctgccgatgtccccccgcactttagattcattgatgcagtttggaaataat
ggtgaagctgctgaaccctcagcaggagggcagtttgagtccctcacgttcgacatggag
ctgacctcggagtgcgctacctcccccatgtga

DBGET integrated database retrieval system