KEGG   Bos indicus (zebu cattle): 109573853
Entry
109573853         CDS       T04792                                 

Gene name
MAP2K6
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 6 isoform X1
  KO
K04433  mitogen-activated protein kinase kinase 6 [EC:2.7.12.2]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04015  Rap1 signaling pathway
biu04218  Cellular senescence
biu04380  Osteoclast differentiation
biu04620  Toll-like receptor signaling pathway
biu04664  Fc epsilon RI signaling pathway
biu04668  TNF signaling pathway
biu04750  Inflammatory mediator regulation of TRP channels
biu04912  GnRH signaling pathway
biu04935  Growth hormone synthesis, secretion and action
biu05014  Amyotrophic lateral sclerosis
biu05022  Pathways of neurodegeneration - multiple diseases
biu05132  Salmonella infection
biu05135  Yersinia infection
biu05145  Toxoplasmosis
biu05161  Hepatitis B
biu05163  Human cytomegalovirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109573853 (MAP2K6)
   04015 Rap1 signaling pathway
    109573853 (MAP2K6)
   04668 TNF signaling pathway
    109573853 (MAP2K6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    109573853 (MAP2K6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109573853 (MAP2K6)
   04664 Fc epsilon RI signaling pathway
    109573853 (MAP2K6)
  09152 Endocrine system
   04912 GnRH signaling pathway
    109573853 (MAP2K6)
   04935 Growth hormone synthesis, secretion and action
    109573853 (MAP2K6)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109573853 (MAP2K6)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109573853 (MAP2K6)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109573853 (MAP2K6)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    109573853 (MAP2K6)
   05022 Pathways of neurodegeneration - multiple diseases
    109573853 (MAP2K6)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109573853 (MAP2K6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109573853 (MAP2K6)
   05135 Yersinia infection
    109573853 (MAP2K6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109573853 (MAP2K6)
   05161 Hepatitis B
    109573853 (MAP2K6)
   05163 Human cytomegalovirus infection
    109573853 (MAP2K6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109573853 (MAP2K6)
   05169 Epstein-Barr virus infection
    109573853 (MAP2K6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109573853 (MAP2K6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109573853 (MAP2K6)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     109573853 (MAP2K6)
Protein kinases [BR:biu01001]
 Serine/threonine kinases: STE group
  STE7 family
   109573853 (MAP2K6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal DUF4344 Choline_kinase APH
Other DBs
NCBI-GeneID: 109573853
NCBI-ProteinID: XP_019836916
UniProt: A0A6P5DFB2
LinkDB
Position
19
AA seq 395 aa
MCWDADLCLGLPPRGGPAAGWAFSQLWMQWCACRGLQGREGTAVFGLSEREVQEACRSLL
LRCRVPGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIVEL
GRGAYGVVEKMRHVPSEQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGAL
FREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRD
VKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSD
IWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSEEFVDFTSQCLKKXS
KERPTYPELMQHPFFTLHESKATDVASFVKSILGD
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgtgctgggacgcagatctgtgccttggtctgccgcctcgtggtggcccggcggcgggc
tgggctttctcgcagctgtggatgcagtggtgcgcttgcagaggccttcagggcagggaa
ggcacagctgtattcgggttaagtgagcgtgaagtccaggaagcatgtcgctctctcctc
cttcgctgtagggtgccaggcaagaagcgaaaccctggccttaaaattcccaaagaagca
tttgaacaacctcagaccagttccacgccaccgcgggatttagactccaaagcttgcatt
tctattggaaatcagaactttgaggtgaaggcggatgacctggagcccatcgtggagctg
ggccggggggcgtacggggtggtggagaagatgcggcacgtgcccagcgagcagatcatg
gcggtgaagcggatccgggccacggtaaacagccaagagcagaagcggctcctgatggat
ctggatatctccatgaggaccgtggactgtcccttcacggtcaccttttacggcgcactc
ttccgtgagggggatgtctggatctgcatggagctcatggacacgtccctagataaattc
tacaaacaagtgatcgataaaggccaaacaattccagaggacatcttagggaaaatagca
gtttctattgtaaaagccttagagcatttgcacagtaagctgtctgtcattcaccgagat
gtcaagccctccaacgtgctcatcaacgctctgggccaggtgaagatgtgcgacttcgga
atcagcggctacctggtcgactccgtggctaaaaccatcgatgccggatgcaaaccgtac
atggcccccgagagaataaacccagagctcaaccagaagggatacagcgtgaagtccgac
atctggagtttgggcatcaccatgattgagctggccatcctccggtttccctacgactca
tgggggactcctttccagcagctcaaacaggtggtggaggagccgtcgccgcagctgccc
gcagacaagttctccgaagagtttgttgactttacctcacagtgcttgaagaagarttcc
aaagaaaggccaacatatccagagcttatgcaacatccgtttttcaccctacacgaatcc
aaagcgacagacgtggcatcttttgtaaaatcaattcttggagactaa

KEGG   Bos indicus (zebu cattle): 109574182
Entry
109574182         CDS       T04792                                 

Gene name
MAP2K3
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 3
  KO
K04432  mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04015  Rap1 signaling pathway
biu04218  Cellular senescence
biu04620  Toll-like receptor signaling pathway
biu04664  Fc epsilon RI signaling pathway
biu04668  TNF signaling pathway
biu04714  Thermogenesis
biu04750  Inflammatory mediator regulation of TRP channels
biu04912  GnRH signaling pathway
biu04935  Growth hormone synthesis, secretion and action
biu05014  Amyotrophic lateral sclerosis
biu05022  Pathways of neurodegeneration - multiple diseases
biu05132  Salmonella infection
biu05135  Yersinia infection
biu05145  Toxoplasmosis
biu05161  Hepatitis B
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109574182 (MAP2K3)
   04015 Rap1 signaling pathway
    109574182 (MAP2K3)
   04668 TNF signaling pathway
    109574182 (MAP2K3)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    109574182 (MAP2K3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109574182 (MAP2K3)
   04664 Fc epsilon RI signaling pathway
    109574182 (MAP2K3)
  09152 Endocrine system
   04912 GnRH signaling pathway
    109574182 (MAP2K3)
   04935 Growth hormone synthesis, secretion and action
    109574182 (MAP2K3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109574182 (MAP2K3)
  09159 Environmental adaptation
   04714 Thermogenesis
    109574182 (MAP2K3)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109574182 (MAP2K3)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    109574182 (MAP2K3)
   05022 Pathways of neurodegeneration - multiple diseases
    109574182 (MAP2K3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109574182 (MAP2K3)
   05135 Yersinia infection
    109574182 (MAP2K3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109574182 (MAP2K3)
   05161 Hepatitis B
    109574182 (MAP2K3)
   05169 Epstein-Barr virus infection
    109574182 (MAP2K3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109574182 (MAP2K3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109574182 (MAP2K3)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     109574182 (MAP2K3)
Protein kinases [BR:biu01001]
 Serine/threonine kinases: STE group
  STE7 family
   109574182 (MAP2K3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH Choline_kinase
Other DBs
NCBI-GeneID: 109574182
NCBI-ProteinID: XP_019837569
UniProt: A0A6P5DIM4
LinkDB
Position
19
AA seq 347 aa
MESPAPSPPAGVPTSKGKSRRKKDLRISCMSKPPAPSPTLPRNLDSRAFITIGDRNFEVE
ADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDVNMRTVDC
FYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKGMTIPEDILGEIAVSIVRALEHL
HSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPEL
NQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVD
FTAQCLRKNPAERMSYLELMEHPFFTSHKTKKTDIAAFVKEILGEDS
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggagtcccctgccccgagcccgcccgccggcgtgcccacgtccaaaggaaagtccagg
aggaaaaaggatttacgaatctcctgcatgtccaagccgccggcgcccagccccacgctc
ccccggaacctggactcccgggcattcatcaccattggagacaggaactttgaggtggag
gcggatgacctggtgaccatttcagagctgggccgaggtgcctatggggtggtggagaag
gtgcggcatgcccagagtggcaccatcatggccgtgaagcgcatccgggccaccgtgaac
tctcaggagcagaagcgcctgctcatggacctagatgtcaacatgcgcacggtggactgt
ttctacaccgtcaccttctatggggccctctttagagagggagacgtgtggatctgcatg
gagctcatggacacgtccctggacaagttctatcggaaggtgctagacaagggcatgacg
atcccagaagacattctcggggagatcgctgtgtctatcgtgagggccctggaacacctg
cacagcaagctgtccgtgatccacagagatgtgaagccgtccaatgtccttatcaacaag
gagggccacgtgaagatgtgtgactttgggatcagtggttacttggtggattccgtggcc
aagacaatggatgctggctgcaaaccctacatggcccctgagagaatcaacccagaactg
aaccagaaaggctacaatgtcaagtccgatgtctggagcctcggcatcaccatgatcgag
atggccattctgcgatttccttacgagtcctgggggacccccttccagcagctgaagcag
gtggtagaggagccgtccccccagctcccagctgaccgtttctcccctgagtttgtggac
tttactgcacagtgcctgagaaagaaccccgcggaacgcatgagctacctggagctgatg
gagcaccctttcttcacctcgcacaaaaccaagaagactgacatcgctgccttcgtgaag
gagatcctgggagaggactcgtag

DBGET integrated database retrieval system