KEGG   Bos indicus (zebu cattle): 109574014
Entry
109574014         CDS       T04792                                 

Gene name
GFAP
Definition
(RefSeq) glial fibrillary acidic protein isoform X1
  KO
K05640  glial fibrillary acidic protein
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109574014 (GFAP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109574014 (GFAP)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:biu04812]
    109574014 (GFAP)
Membrane trafficking [BR:biu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Other CMA associated proteins
    109574014 (GFAP)
Cytoskeleton proteins [BR:biu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type III
     109574014 (GFAP)
SSDB
Motif
Pfam: Filament Filament_head Spc7 DUF1664 Fib_alpha DUF4407 GAS
Other DBs
NCBI-GeneID: 109574014
NCBI-ProteinID: XP_019837250
UniProt: A0A6P5DIN6
LinkDB
Position
19
AA seq 428 aa
MERRRVTSATRRSYVSSSEMVVGGRRLGPGTRLSLARMPPPLPARVDFSLAGALNSGFKE
TRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAELRELR
LRLDQLTANSARLEVERDNLAQDLGTLRQKLQDETNQRLEAENNLAAYRQEADEATLARL
DLERKIESLEEEIRFLRKIHEEEVRELQEQLAXXXXHVEMDVAKPDLTAALREIRTQYEA
VASSNMHEAEEWYRSKFADLNDAAARNAELLRQAKHEANDYRRQLQALTCDLESLRGTNE
SLERQMREQEERHAREAASYQEALARLEEEGQSLKDEMARHLQEYQDLLNVKLALDIEIA
TYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEVIKES
KQEHKDVM
NT seq 1287 nt   +upstreamnt  +downstreamnt
atggagaggagacgggtcacctcagccactcgccgctcctatgtctcctcctcagagatg
gtggtggggggccgccgcctgggtcccggcacccgcctgtccctggctcgaatgccgcct
ccactcccagcccgggtggacttctccctggccggggcactcaactccggcttcaaggag
acccgggccagcgagagggcagagatgatggagctcaatgaccgcttcgccagctacatt
gagaaggtgcgcttcctggagcagcagaacaaggcgctggctgccgagctcaaccagctg
cgggccaaggaacccaccaagctggccgacgtctaccaggcggagctgcgcgagctgcgc
ctgcggctcgatcaactcactgccaacagcgcccggctcgaggtggagagggacaacctg
gcacaggacctgggcaccttgaggcagaagctccaggatgaaaccaaccagaggctggag
gctgagaacaacctggctgcctatcgacaggaagcagatgaagccaccctggcccgtctg
gatctggagaggaagattgagtctctggaggaggaaatccggttcttgaggaagatccat
gaggaggaggtgcgggagctccaggagcagctggcccnnnnnnnnntccacgtggagatg
gatgtagccaagcctgacctcacagcggccctgagagagatccgcacacagtatgaggca
gtggcatccagcaacatgcatgaggcggaggagtggtaccggtccaagtttgcggacctc
aacgacgccgccgcccgcaacgcggagctgctccgccaggccaagcatgaggccaacgac
taccggcggcagctgcaggccttgacctgcgacctggagtccttgcgcggcacgaacgag
tccctggagcggcagatgcgcgagcaagaggagcgccacgcgcgggaggcggcgagttac
caggaggcgctggcccggctggaggaagaggggcagagcctcaaggacgagatggcgcgc
cacctgcaggaataccaggatctgctcaacgtcaaactggccctggacatcgagatcgcc
acctacaggaagctgctagagggcgaggagaaccgcatcaccattcctgtgcagaccttc
tccaacctgcagatccgagaaaccagcctggacaccaagtccgtgtcagaaggccacctc
aagaggaacattgtggtgaagaccgtggagatgcgggatggagaggtcattaaggagtcc
aagcaggagcacaaggatgtgatgtga

DBGET integrated database retrieval system