KEGG   Bos indicus (zebu cattle): 109574062Help
Entry
109574062         CDS       T04792                                 

Gene name
GAA
Definition
(RefSeq) lysosomal alpha-glucosidase
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00052  Galactose metabolism
biu00500  Starch and sucrose metabolism
biu01100  Metabolic pathways
biu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    109574062 (GAA)
   00500 Starch and sucrose metabolism
    109574062 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    109574062 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109574062 (GAA)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     109574062 (GAA)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109574062 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 109574062
NCBI-ProteinID: XP_019837343
LinkDB All DBs
Position
19
AA seq 937 aa AA seqDB search
MMRWPPCSRPLLGVCTLLSLALLGHILLHDLEVVPRELRGFSQDEIHQACQPGASSPECR
GSPRAAPTQCDLPPNSRFDCAPDKGITPQQCEARGCCYMPAERPPDAQMGQPWCFFPPSY
PSYRLENLTTTETGYTATLTRAVPTFFPKDIMTLRLDMLMETESRLHFTIKDPANRRYEV
PLETPRVYSQAPFTLYSVEFSEEPFGVVVRRKLDGRVLLNTTVAPLFFADQFLQLSTSLP
SQHITGLAEHLGSLMLSTNWTKITLWNRDIAPEPNVNLYGSHPFYLVLEDGGLAHGVFLL
NSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSVVQQYLDVVGYPFMPPYWGLGFHL
CRWGYSTSAITRQVVENMTRAYFPLDVQWNDLDYMDARRDFTFNKDHFGDFPAMVQELHQ
GGRRYIMIVDPAISSSGPAGTYRPYDEGLRRGVFITNETGQPLXGQVWPGLTAFPDFTNP
ETLDWWQDMVTEFHAQVPFDGMWIDMNEPSNFVRGSVDGCPDNSLENPPYLPGVVGGTLR
AATICASSHQFLSTHYDLHNLYGLTEALASHRALVKARGMRPFVISRSTFAGHGRYSGHW
TGDVWSNWEQLSYSVPEILLFNLLGVPLVGADICGFLGNTSEELCVRWTQLGAFYPFMRN
HNALNSQPQEPYRFSETAQQAMRKAFTLRYVLLPYLYTLFHGAHVRGETVARPLFLEFPE
DPSTWTVDRQLLWGEALLITPVLEAEKVEVTGYFPQGTWYDLQTVPMEAFGSLPPPAPLT
SVIHSKGQWVTLSAPLDTINVHLRAGHIIPMQGPALTTTESRKQHMALXVALTASGEAQG
ELFWDDGESLGVLDGGDYTQLIFLAKNNTFVNKLVHVSSEGASLQLRNVTVLGVATAPQQ
VLCNSVPVSNFTFSPDTETLAIPVSLTMGEQFVISWS
NT seq 2814 nt NT seq  +upstreamnt  +downstreamnt
atgatgaggtggccaccatgctcccgccccctgctgggggtctgcaccctcctctccttg
gcgctcctgggacacatcctgcttcatgacttggaggtggtcccccgagaactacgaggc
ttctcccaagacgagattcaccaagcttgccagccaggagccagcagcccagaatgccgt
ggcagccccagggcagcacctacacagtgcgacctgccccccaacagccgcttcgactgc
gccccagacaagggcatcaccccgcagcagtgtgaggcccgtggctgctgctacatgcct
gcagagcggcctccggatgcccagatggggcagccctggtgcttcttccctcccagctac
cccagttacaggctggagaacctgaccaccactgagacagggtacacagccaccctgacc
cgtgccgtcccgaccttcttccccaaggacatcatgaccttgaggctggacatgttgatg
gagaccgagagccgactccacttcacgatcaaagatcctgccaacagacgctatgaagtg
cccttggagaccccgcgtgtctatagccaggcgccgttcacactctacagcgtggagttc
tcggaggagccctttggggtggtcgtgcggcggaagctggacggacgggtgctgctgaac
accacggtggcccccctgttctttgcggaccagtttctgcagctgtccacctccctgcca
tcccagcacatcacaggccttgccgaacaccttgggtccctgatgctcagcaccaactgg
accaagatcaccctctggaaccgggacatcgcccctgagcccaacgtgaacctgtatgga
tctcaccctttctacctggtcctggaggatggcgggttggctcacggggtcttcctgctg
aacagcaatgccatggatgtggtcctgcagcccagcccagccctcagctggaggtcgaca
ggcgggatcctggacgtgtacatcttcctgggcccggagcccaagagcgtggtgcagcag
tacctggacgtygtgggctacccgttcatgccgccgtattggggcctgggcttccacctg
tgccgctggggctactccacctctgccatcacccgccaggtcgtggagaatatgaccagg
gcctacttccccctggacgtccagtggaatgacctcgactacatggatgccagacgggac
ttcactttcaacaaggaccacttcggggacttcccggccatggtgcaggagctccaccag
ggcggtcggcggtacatcatgatcgtggatcctgccatcagcagctcaggccctgctggg
acctaccgaccctacgacgagggtctgaggcggggggtcttcatcaccaatgagactggg
cagccactgatkgggcaggtgtggcccggactcaccgccttccccgacttcaccaacccc
gaaactcttgactggtggcaggacatggtgaccgagttccacgcccaagtgcccttcgat
ggcatgtggatcgatatgaacgagccatccaatttcgtgaggggctcagtggatggctgc
ccggacaacagcctggagaacccgccctacctgccaggggtggttggcgggaccctccgg
gcagccaccatctgtgcctccagccaccagttcctgtccacgcattatgacctgcacaac
ctgtatggcctgactgaagccttagcctcccacagggccctggtgaaggctcgagggatg
cgtcccttcgtgatctctcgctcaacctttgcyggccacggccgatactccggccactgg
acaggggatgtgtggagcaactgggagcagctttcctactccgtgccagaaatcctgctt
ttcaatctgctgggggtgcccctggtaggggctgacatctgtggcttcctgggcaacacc
tcagaggagctgtgtgtgcgttggacccagctgggggccttctaccccttcatgcggaac
cacaatgccctgaacagccagccgcaggaaccgtacaggttcagcgagacggcgcagcaa
gccatgaggaaggccttcaccctgcgctacgtgctactgccctatctctacacactgttc
cacggggcccacgtcagaggcgagacagtggcccggccccttttcctggagttccccgag
gaccccagcacctggactgtggaccgccagctcctgtggggggaggctctgctcatcacc
ccggtgctcgaggctgagaaggttgaagtcactggctacttcccccagggcacgtggtac
gacctgcagacggtaccaatggaggcctttggcagcctcccacctcctgcacccctcacg
tctgtcatccacagcaaggggcagtgggtgacgctgtccgccccgctggacaccatcaac
gtccacctccgggccgggcacatcatccctatgcagggccctgccctcacgaccacagag
tcccgcaagcagcacatggctctgnntgtggccctgacagccagtggggaggcccaaggg
gagctgttctgggacgacggggagagcctgggagtgctggatggtggggactacacacag
ctcatctttctggccaagaacaacacctttgtaaacaagctggtgcacgtgagcagtgag
ggggccagcctgcagctgaggaatgtgaccgtcctgggggtggccacagccccccagcag
gtcctctgcaacagcgttcctgtctccaacttcaccttcagccctgacacagagactctg
gccatccctgtctcgctgaccatgggagagcagtttgtcatcagctggtcttaa

DBGET integrated database retrieval system