KEGG   Bos indicus (zebu cattle): 109574140
Entry
109574140         CDS       T04792                                 

Gene name
ITGB3
Definition
(RefSeq) integrin beta-3 isoform X1
  KO
K06493  integrin beta 3
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04015  Rap1 signaling pathway
biu04145  Phagosome
biu04151  PI3K-Akt signaling pathway
biu04380  Osteoclast differentiation
biu04510  Focal adhesion
biu04512  ECM-receptor interaction
biu04611  Platelet activation
biu04613  Neutrophil extracellular trap formation
biu04640  Hematopoietic cell lineage
biu04810  Regulation of actin cytoskeleton
biu04919  Thyroid hormone signaling pathway
biu05163  Human cytomegalovirus infection
biu05165  Human papillomavirus infection
biu05168  Herpes simplex virus 1 infection
biu05205  Proteoglycans in cancer
biu05206  MicroRNAs in cancer
biu05410  Hypertrophic cardiomyopathy
biu05412  Arrhythmogenic right ventricular cardiomyopathy
biu05414  Dilated cardiomyopathy
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    109574140 (ITGB3)
   04151 PI3K-Akt signaling pathway
    109574140 (ITGB3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    109574140 (ITGB3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109574140 (ITGB3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109574140 (ITGB3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109574140 (ITGB3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109574140 (ITGB3)
   04611 Platelet activation
    109574140 (ITGB3)
   04613 Neutrophil extracellular trap formation
    109574140 (ITGB3)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    109574140 (ITGB3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109574140 (ITGB3)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    109574140 (ITGB3)
   05205 Proteoglycans in cancer
    109574140 (ITGB3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109574140 (ITGB3)
   05410 Hypertrophic cardiomyopathy
    109574140 (ITGB3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    109574140 (ITGB3)
   05414 Dilated cardiomyopathy
    109574140 (ITGB3)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109574140 (ITGB3)
   05163 Human cytomegalovirus infection
    109574140 (ITGB3)
   05165 Human papillomavirus infection
    109574140 (ITGB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109574140 (ITGB3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109574140 (ITGB3)
   04515 Cell adhesion molecules [BR:biu04515]
    109574140 (ITGB3)
   04090 CD molecules [BR:biu04090]
    109574140 (ITGB3)
Membrane trafficking [BR:biu04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    109574140 (ITGB3)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109574140 (ITGB3)
Cell adhesion molecules [BR:biu04515]
 Integrins
  Integrin beta subunits
   109574140 (ITGB3)
CD molecules [BR:biu04090]
 Proteins
  109574140 (ITGB3)
SSDB
Motif
Pfam: Integrin_beta Integrin_B_tail Integrin_b_cyt PSI_integrin I-EGF_1 EGF_2
Other DBs
NCBI-GeneID: 109574140
NCBI-ProteinID: XP_019837494
UniProt: A0A6P5DIF2
LinkDB
Position
19
AA seq 784 aa
MRARRLWAAVLVVGALAGVGVGGPNICATRGVSSCQQCLAVSPTCAWCSDEALPPGSPRC
NLKENLLKDNCHPESIEFPISEARILEARPLSDKGTGDSSQITQVSPQRIALRLRPDDSK
IFSVQVRQVEDYPVDIYYLMDLSYSMKDDLRNIQNLGTKLASQMRKLTSNLRIGFGAFVD
KPVSPYMYISPPEAIRNPCYDMKATCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDA
PEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSD
NHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTESVVSLYQNYSELIPGTTVGVLSTDSS
NVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCVGLKIGDTVSFS
IEAKVRGCPQKKEKSFTIKPVGFKDSLTVQVTFDCDCACQAEAEPFSHRCNNGNGTFECG
VCRCGPGWLGSQCECSEEDYRPSQQDECSPREGQPICSQRGECLCGQCVCHSSDFGKITG
KYCECDDFSCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLLCSGR
GKCECGSCVCIQPGSYGDTCEKCPTCPDACTFKKECVECKKFNRGALNEENTCNRYCRDE
IEPVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPDILVVLL
SVMGAILLIGLATLLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFTNIT
YRGT
NT seq 2355 nt   +upstreamnt  +downstreamnt
atgcgagcgcggcggctctgggcagcggtgctggtggtgggggcgctggcgggcgtcggc
gtcggagggcccaacatctgtgccacacgaggtgtgagctcctgccagcaatgtctggct
gtgagtcccacatgtgcctggtgctcagatgaggcgctgcctccaggctcgccccgctgt
aacctgaaggagaacctgctgaaggataactgccacccggagtccatcgagttccctatc
agcgaggccagaatcctggaggccaggcccctcagtgacaagggcactggagacagctcc
cagattacccaagtcagtccccagaggattgccctccgcctacggccagatgattcgaag
attttctccgtccaagttcggcaggtggaagattaccctgtggacatctactacttaatg
gacttgtcttactccatgaaggatgacctgcggaacatccagaacctgggtaccaagctg
gcctcccagatgcgtaagctcaccagtaacctgcggattggcttcggggcctttgtggac
aagcccgtgtcaccatacatgtatatttctccaccagaggctatcagaaacccttgctat
gatatgaaggctacctgtttgcccatgtttggctacaaacatgtgctgacactaactgac
caggtgacccgcttcaatgaggaggtgaagaagcagagtgtgtcacggaaccgagatgcc
ccagagggtggttttgatgccatcatgcaggctaccgtctgtgatgagaagattggctgg
aggaatgatgcctcccacttgctggtgtttaccactgatgccaagacccatatagcgctg
gatggaaggctggcaggcatcgtccagcccaatgatgggcagtgtcatgtgggcagtgac
aaccattattctgcctccaccaccatggattatccttccttggggctgatgactgagaag
ctatcccagaaaaacatcaatttgatctttgcagtgactgaaagtgtagtcagtctctac
cagaactatagtgagctcatcccagggaccacagtgggggttctgtctactgattccagc
aatgttctccagctcattgtggatgcttatgggaaaatccgctctaaagtagagctggaa
gtgcgtgacctccccgaagagctgtccttatccttcaacgccacatgtctcaacaacgaa
gtcatcccaggcctgaagtcttgcgttggactcaagattggagacacggtgagcttcagc
attgaggccaaagtgcgtggctgtccccagaagaaggagaagtccttcaccatcaagcct
gtgggcttcaaagacagcctcaccgtgcaggtcactttcgactgtgactgtgcctgccag
gccgaggctgagccttttagccaccgctgcaacaatggcaatgggacctttgartgtggg
gtgtgccgctgtgggcccggctggctggggtcccagtgtgagtgctcagaagaggactac
cgcccctcgcagcaggacgagtgcagcccccgggagggccagcccatctgtagccagcgg
ggcgagtgtctctgtggccagtgcgtctgccacagcagtgactttggcaagatcacgggc
aagtactgtgagtgtgatgacttctcctgtgtccgctacaagggggagatgtgctcaggc
catggccagtgcagctgtggggactgyctgtgtgactccgactggactggctactactgc
aactgtaccacacgcacggacacctgcatgtccagcaacggcttgctgtgcagcggacgg
ggcaagtgtgagtgcggcagctgtgtctgcatccagccgggctcctatggggacacctgt
gagaagtgtcccacctgccctgacgcctgcacctttaagaaggagtgtgtggaatgtaag
aagtttaaccggggagccctcaacgaggaaaatacctgcaaccgttattgtcgtgatgag
attgagcctgtgaaggaacttaaggacactggcaaggatgctgtgaattgtacctacaag
aatgaggatgactgtgttgtcagattccagtactacgaagactccagtggaaagtccatt
ttgtatgtggtggaagagccagagtgtcccaagggccctgacatcctggtggtcttgcta
tccgtgatgggggccattctgctcatcggccttgcgactctgctcatctggaagctcctc
atcaccatccatgaccggaaggagtttgctaaatttgaagaagagagagccagagccaaa
tgggacactgccaacaacccactgtataaagaggctacatccaccttcaccaacatcacc
tacaggggcacttaa

DBGET integrated database retrieval system