KEGG   Bos indicus (zebu cattle): 109574238
Entry
109574238         CDS       T04792                                 

Gene name
TP53
Definition
(RefSeq) cellular tumor antigen p53
  KO
K04451  tumor protein p53
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01522  Endocrine resistance
biu01524  Platinum drug resistance
biu04010  MAPK signaling pathway
biu04071  Sphingolipid signaling pathway
biu04110  Cell cycle
biu04115  p53 signaling pathway
biu04137  Mitophagy - animal
biu04151  PI3K-Akt signaling pathway
biu04210  Apoptosis
biu04211  Longevity regulating pathway
biu04216  Ferroptosis
biu04218  Cellular senescence
biu04310  Wnt signaling pathway
biu04722  Neurotrophin signaling pathway
biu04919  Thyroid hormone signaling pathway
biu05012  Parkinson disease
biu05014  Amyotrophic lateral sclerosis
biu05016  Huntington disease
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05200  Pathways in cancer
biu05202  Transcriptional misregulation in cancer
biu05203  Viral carcinogenesis
biu05205  Proteoglycans in cancer
biu05206  MicroRNAs in cancer
biu05210  Colorectal cancer
biu05212  Pancreatic cancer
biu05213  Endometrial cancer
biu05214  Glioma
biu05215  Prostate cancer
biu05216  Thyroid cancer
biu05217  Basal cell carcinoma
biu05218  Melanoma
biu05219  Bladder cancer
biu05220  Chronic myeloid leukemia
biu05222  Small cell lung cancer
biu05223  Non-small cell lung cancer
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
biu05230  Central carbon metabolism in cancer
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109574238 (TP53)
   04310 Wnt signaling pathway
    109574238 (TP53)
   04071 Sphingolipid signaling pathway
    109574238 (TP53)
   04151 PI3K-Akt signaling pathway
    109574238 (TP53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    109574238 (TP53)
  09143 Cell growth and death
   04110 Cell cycle
    109574238 (TP53)
   04210 Apoptosis
    109574238 (TP53)
   04216 Ferroptosis
    109574238 (TP53)
   04115 p53 signaling pathway
    109574238 (TP53)
   04218 Cellular senescence
    109574238 (TP53)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    109574238 (TP53)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    109574238 (TP53)
  09149 Aging
   04211 Longevity regulating pathway
    109574238 (TP53)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109574238 (TP53)
   05202 Transcriptional misregulation in cancer
    109574238 (TP53)
   05206 MicroRNAs in cancer
    109574238 (TP53)
   05205 Proteoglycans in cancer
    109574238 (TP53)
   05203 Viral carcinogenesis
    109574238 (TP53)
   05230 Central carbon metabolism in cancer
    109574238 (TP53)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109574238 (TP53)
   05212 Pancreatic cancer
    109574238 (TP53)
   05225 Hepatocellular carcinoma
    109574238 (TP53)
   05226 Gastric cancer
    109574238 (TP53)
   05214 Glioma
    109574238 (TP53)
   05216 Thyroid cancer
    109574238 (TP53)
   05220 Chronic myeloid leukemia
    109574238 (TP53)
   05217 Basal cell carcinoma
    109574238 (TP53)
   05218 Melanoma
    109574238 (TP53)
   05219 Bladder cancer
    109574238 (TP53)
   05215 Prostate cancer
    109574238 (TP53)
   05213 Endometrial cancer
    109574238 (TP53)
   05224 Breast cancer
    109574238 (TP53)
   05222 Small cell lung cancer
    109574238 (TP53)
   05223 Non-small cell lung cancer
    109574238 (TP53)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    109574238 (TP53)
   05014 Amyotrophic lateral sclerosis
    109574238 (TP53)
   05016 Huntington disease
    109574238 (TP53)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109574238 (TP53)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109574238 (TP53)
   05161 Hepatitis B
    109574238 (TP53)
   05160 Hepatitis C
    109574238 (TP53)
   05162 Measles
    109574238 (TP53)
   05168 Herpes simplex virus 1 infection
    109574238 (TP53)
   05163 Human cytomegalovirus infection
    109574238 (TP53)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109574238 (TP53)
   05169 Epstein-Barr virus infection
    109574238 (TP53)
   05165 Human papillomavirus infection
    109574238 (TP53)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    109574238 (TP53)
   01522 Endocrine resistance
    109574238 (TP53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109574238 (TP53)
   03036 Chromosome and associated proteins [BR:biu03036]
    109574238 (TP53)
   03400 DNA repair and recombination proteins [BR:biu03400]
    109574238 (TP53)
Transcription factors [BR:biu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    109574238 (TP53)
Chromosome and associated proteins [BR:biu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     109574238 (TP53)
DNA repair and recombination proteins [BR:biu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    109574238 (TP53)
SSDB
Motif
Pfam: P53 P53_tetramer P53_TAD DEC-1_N
Other DBs
NCBI-GeneID: 109574238
NCBI-ProteinID: XP_019837670
UniProt: P67938
LinkDB
Position
19
AA seq 386 aa
MEESQAELNVEPPLSQETFSDLWNLLPENNLLSSELSAPVDDLLPYTDVATWLDECPNEA
PQMPEPSAPAAPPPATPAPATSWPLSSFVPSQKTYPGNYGFRLGFLQSGTAKSVTCTYSP
SLNKLFCQLAKTCPVQLWVDSPPPPGTRVRAMAIYKKLEHMTEVVRRCPHHERSSDYSDG
LAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPYESPEIDSECTTIHYNFMCNSSCMGGMN
RRPILTIITLEDSCGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGQSCPEPPPRSTKRA
LPTNTSSSPQPKKKPLDGEYFTLQIRGFKRYEMFRELNDALELKDALDGREPGESRAHSS
HLKSKKRPSPSCHKKPMLKREGPDSD
NT seq 1161 nt   +upstreamnt  +downstreamnt
atggaagaatcacaggcagaactcaatgtggagccccctctgagtcaggagacattttcc
gacttgtggaacctacttcctgaaaataaccttctgtcctccgagctctccgcacccgtg
gatgacctgctcccgtacacagatgttgccacctggctggatgaatgtccgaatgaagcg
ccccaaatgccagagccttctgccccagctgccccgccaccagccaccccagcaccagcc
acctcctggcccctgtcgtcctttgtcccctcccagaagacctaccctggcaattacggt
ttccgtctagggttcctgcaatccggaacagccaagtccgtgacctgcacgtattcccct
tcccttaacaagctgttctgccagctggccaagacctgcccagtgcagctgtgggtcgac
tcgccacccccgcccggcacccgcgtccgcgccatggccatctacaagaagttggagcac
atgacggaggttgtgaggcgttgtccccaccatgagcgctcctctgactatagcgatggt
ctggcccctcctcagcaccttatccgggtggaagggaatttacgcgcggagtatttggac
gaccggaacacctttagacacagtgtggtggtgccctatgagtcccccgagatcgactct
gagtgcaccaccatccactacaatttcatgtgtaacagctcctgcatggggggcatgaac
cggcggcccatcctcaccatcatcacactggaagactcttgtggtaacctgctgggacgg
aacagctttgaggtgcgtgtttgtgcctgtcctgggagagaccgccgcactgaggaagaa
aatcttcgcaagaaggggcagtcttgccccgagccaccccctaggagcactaagcgagca
ctgcctaccaacaccagctcctctccacagccaaagaagaaaccactggatggagagtac
ttcactcttcagatccgtgggtttaaacgctatgagatgttccgagagctgaatgatgcc
ttggagctgaaggatgctctggatggaagggaaccaggggaaagcagggctcactctagc
cacctgaagtctaagaagaggccttctccctcctgccataaaaaaccaatgctcaagaga
gagggacctgactcagactga

DBGET integrated database retrieval system