KEGG   Bos indicus (zebu cattle): 109574440
Entry
109574440         CDS       T04792                                 

Gene name
BIRC5
Definition
(RefSeq) baculoviral IAP repeat-containing protein 5
  KO
K08731  baculoviral IAP repeat-containing protein 5
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01524  Platinum drug resistance
biu04210  Apoptosis
biu04215  Apoptosis - multiple species
biu04390  Hippo signaling pathway
biu05161  Hepatitis B
biu05200  Pathways in cancer
biu05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    109574440 (BIRC5)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109574440 (BIRC5)
   04215 Apoptosis - multiple species
    109574440 (BIRC5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109574440 (BIRC5)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109574440 (BIRC5)
  09172 Infectious disease: viral
   05161 Hepatitis B
    109574440 (BIRC5)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    109574440 (BIRC5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109574440 (BIRC5)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:biu03036]
    109574440 (BIRC5)
Peptidases and inhibitors [BR:biu01002]
 Peptidase inhibitors
  Family I32: IAP family
   109574440 (BIRC5)
Chromosome and associated proteins [BR:biu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CPC (chromosomal passenger complex)
     109574440 (BIRC5)
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    109574440 (BIRC5)
SSDB
Motif
Pfam: BIR
Other DBs
NCBI-GeneID: 109574440
NCBI-ProteinID: XP_019838018
UniProt: A0A6P5DII3
LinkDB
Position
19
AA seq 142 aa
MGAQSLPPAWQLYLKDHRVSTFKNWPFLEGCACTPERMAAAGFIHCPTENEPDLAQCFFC
FKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLSEFLKLDKERTKNKIAKETNNK
QKEFEETAKKVRCAIEQLAALE
NT seq 429 nt   +upstreamnt  +downstreamnt
atgggtgcccagtctttgcctccggcctggcagctctacctcaaggaccaccgcgtctcc
acgtttaagaactggcctttcttagagggctgcgcctgcaccccggagcggatggccgcg
gcaggcttcatccactgtcccactgagaacgagcccgacttggctcagtgtttcttctgc
ttcaaggagttggaaggctgggaaccagatgacgaccctatagaagaacataaaaagcat
tcatctggttgtgctttcctttctgtcaagaagcagtttgaagaattaaccctcagtgaa
tttttgaaactggataaagaaagaaccaagaacaaaatcgcaaaagaaaccaacaataag
cagaaagaatttgaagaaactgcaaagaaagtccgctgtgccattgagcagctggctgcc
ttggagtga

DBGET integrated database retrieval system