KEGG   Bos indicus (zebu cattle): 109574459
Entry
109574459         CDS       T04792                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00220  Arginine biosynthesis
biu00330  Arginine and proline metabolism
biu01100  Metabolic pathways
biu04020  Calcium signaling pathway
biu04066  HIF-1 signaling pathway
biu04146  Peroxisome
biu04371  Apelin signaling pathway
biu04926  Relaxin signaling pathway
biu05010  Alzheimer disease
biu05014  Amyotrophic lateral sclerosis
biu05022  Pathways of neurodegeneration - multiple diseases
biu05133  Pertussis
biu05140  Leishmaniasis
biu05142  Chagas disease
biu05145  Toxoplasmosis
biu05146  Amoebiasis
biu05152  Tuberculosis
biu05200  Pathways in cancer
biu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    109574459 (NOS2)
   00330 Arginine and proline metabolism
    109574459 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    109574459 (NOS2)
   04066 HIF-1 signaling pathway
    109574459 (NOS2)
   04020 Calcium signaling pathway
    109574459 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109574459 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    109574459 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109574459 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    109574459 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109574459 (NOS2)
   05014 Amyotrophic lateral sclerosis
    109574459 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    109574459 (NOS2)
   05152 Tuberculosis
    109574459 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109574459 (NOS2)
   05145 Toxoplasmosis
    109574459 (NOS2)
   05140 Leishmaniasis
    109574459 (NOS2)
   05142 Chagas disease
    109574459 (NOS2)
Enzymes [BR:biu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     109574459 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 109574459
NCBI-ProteinID: XP_019838052
LinkDB
Position
19
AA seq 1156 aa
MACPWQFLFKIKSQKVDLATELDINNNVGKFYQPPSSPVTQDDPKRHSPGKHGNESPQPL
TGTVKTSPESLSKLDAPPSACPRHVRIKNWGSGVTFQDTLHQKAKGDLSCKSKSCLASIM
NPKSLTIGPRDKPTPPDELLPQAIEFVNQYYXSFKEAKIEEHLARVEAVTKEIETTGTYQ
LTGDVFIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAQEMFEHICRHVRYATNNGNI
RSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGSIRGDPANVEFTQLCIDLGWKPKYG
RFDVLPLVLQADGRDPELFEIPPDLVLEVPMEHPRYEWFRELELKWYALPAVANMLLEVG
GLEFPGCPFNGWYMGTEVGVRDFCDAQRYNILEEVGRRMGLETHKVASLWKDRAVVEINV
AVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPISGSITPVFHQEM
LNYVLSPFYYYQVEPWKTHVWQDERRRPQRREIRFKVLVKAVFFASVLMHKAMASRVRAT
ILFATETGRSETLAQDLGALFSCAFNPKVLCMDQYQLSHLEEEQLLLVVTSTFGNGDSPG
NGEKLKKSLLMLKELTNTFRYAVFGLGSSMYPQFCAFAHDIDQKLSQLGASQLAPTGEGD
ELSGQEEAFRSWAVQTFKAACETFDVSGKHHIEIPKLYTSNVTWDPQHYRLVQDSEPLDL
NKALSSMHAKHVFTMRLKSQQNLQSPKSSRTTLLVELSCEGSQAPSYLPGEHLGVFPCNQ
PALVQGILERVVDGPAPHQPVRLETLCENGSYWVKDKRLPPCSLSQALTYFLDITTPPTQ
LLLRKLAQLATEEAEKQRLETLCQPSDYNKWKFTNSPTFLEVLEEFPSLRVSASFLLSQL
PILKPRYYSISSSRDLTPTEIHLTVAVLTYRTRDGQGPLHHGVCSTWLSSLKPQDPVPCF
VRSASGFQLPEDRSRPCILIGPGTGIAPFRSFWQQRLHEAEHKGLQGGRMTLVFGCRRPE
EDHLYWEEMLEMARKGVLHEVHTAYSRLPDQPKVYVQDILRQRLAGEVLRVLHEEQGHLY
VCGDVRMARDVARTLKQLMATALSLNEEQVEDYFFQLKNQKRYHEDIFGAVFPYEVKKDG
AAGLPSNPRAPGAHRS
NT seq 3471 nt   +upstreamnt  +downstreamnt
atggcctgtccctggcagtttctgttcaaaatcaaatcccaaaaggtggacttggctacg
gaactggacatcaacaacaatgtgggaaaattctaccagcccccgtccagtccagtgaca
caggatgaccccaaacgtcacagcccgggcaagcacgggaatgagtctccccagcccctc
acggggacagtaaagacgtctccagaatccctgagcaagctggacgcgcccccgtcagcc
tgtccacggcatgtgaggatcaaaaactggggcagcggagtgactttccaagacacgctt
caccagaaggccaaaggggatctctcttgcaagtccaagtcttgcctggcatccatcatg
aaccccaaaagtttgaccataggaccccgggacaagccaacccccccagacgagcttcta
cctcaagctatcgaatttgtcaaccagtattacrgctccttcaaagaggcaaaaatagag
gaacatctggccagggtggaagcagtaacaaaggagatagaaacaacaggaacctaccag
ctgacgggagatgtnttcatcttcgccaccaagcaggcctggcgcaacgccccccgctgc
atcggaaggatccagtggtcgaacctgcaggtctttgacgcccggagctgttccacggcc
caggaaatgttcgaacacatctgcagacacgtgcgttatgccaccaacaacggcaacatc
aggtcggccatcactgtgttcccccagcggagcgatgggaagcatgacttccgggtctgg
aacgcccagctcatccgctatgccggctaccagatgccagatggcagcatcagaggggac
cccgccaacgtggagttcacacagctgtgcatcgacctgggctggaagcccaagtacggc
cgcttcgacgtgttgcctctagtcctgcaggctgacggccgtgacccagagctcttcgaa
atcccccctgaccttgttctcgaggtgcccatggaacatcccaggtacgaatggttccgg
gagctggagctcaagtggtacgccctgccagccgtggccaacatgctgcttgaggtgggc
ggcctcgagttcccagggtgccccttcaacgggtggtacatgggcacagaagttggagtc
cgggacttctgcgacgcccagcgatacaacatcctggaggaagtgggcagaaggatgggc
ctggaaacgcacaaggtggcctcactctggaaggaccgggctgtcgttgagatcaacgtc
gctgtgctccacagtttccagaagcagaacgtgaccatcatggaccaccactccgctgca
gagtccttcatgaagtacatgcagaatgagtaccgctcccgagggggctgcccagctgac
tggatttggctggtccccccgatctctggaagcatcacccccgtgttccaccaggagatg
ttaaattacgtcctgtcccctttctactactaccaggtggagccctggaaaacccacgtc
tggcaggacgagaggcggagaccccagagaagagagattcgattcaaagtcttggtcaaa
gccgtgttcttcgcctcggtgctgatgcataaggccatggcatcccgggtcagagccacg
atcctctttgcaacagagacggggagatcggaaacgctggcccaggacctgggggctttg
ttcagctgtgccttcaaccccaaggttctctgcatggatcagtaccagctgagccatctg
gaggaggagcagctgctgctggtggtgaccagcacttttggcaacggagactcccctggc
aacggagagaaactgaagaagtccctcttgatgctgaaagaactcaccaacacgttccgg
tacgccgtgtttggccttggctccagcatgtaccctcagttctgcgcttttgctcatgac
attgaccagaagttgtcccagctgggggcttctcagcttgccccaaccggggaaggggac
gaactcagcgggcaggaggaggcctttcgcagctgggccgtgcaaaccttcaaggcagcc
tgtgagacattcgatgtcagcggcaagcaccacattgagatccccaagctctacacttcc
aatgtgacctgggacccgcagcactacaggctcgtgcaggactcagagcctctggacctc
aacaaagccctgagcagtatgcacgccaagcatgtgttcaccatgaggctcaaatcrcag
cagaatctgcagagtccgaaatccagccgcaccaccctcctggtggaactctcctgtgag
ggcagccaagctccaagctacctgccgggagagcacctcggagttttcccatgcaaccag
ccggccctggttcaaggcatccttgagcgagtggtggatggccctgccccgcaccagcct
gtgcgcctggagaccctctgtgagaatggcagctattgggtcaaggataagcggctgcca
ccttgctcactcagccaggctctcacctatttcctggacatcaccaccccgccaacccag
ctgctgctccgaaagctggcccagctggccacagaagaggctgagaagcagaggctggag
accctatgccagccctcagattacaacaagtggaagttcaccaacagccccacatttctg
gaggtgctggaggagttcccgtccctgcgggtgtctgccagcttcctgctctcccagctc
cctattctgaagccccggtactactccatcagctcctccagggacctcacacccacggag
atccacctcactgtggccgtgctcacgtaccgcacccgagatggccaaggtcccctgcac
catggtgtctgcagcacgtggctcagcagcttgaagccccaagacccggtgccctgcttt
gtgcgaagtgccagcggcttccagcttcccgaggaccgctcccgtccttgcatcctcatt
gggcccggcacgggcatcgcccccttccgcagtttctggcagcagcggctccatgaggct
gagcacaaagggctccagggcggccgcatgaccctggttttcgggtgccgccgcccagaa
gaggaccacctctactgggaggagatgctggagatggcccgcaagggggtgctgcacgag
gtgcacaccgcctattcccgcctgcctgaccagcccaaggtctatgttcaagacatcctg
cggcagcggctggcgggcgaggtgcttcgcgtgctccatgaggagcaaggtcacctctat
gtctgtggggatgtgcgcatggcccgggacgtggcccgcaccctgaagcagctgatggct
actgcgctgagcctgaacgaggaacaggtggaggactatttcttccagctcaagaaccag
aagcgctatcatgaagacatctttggtgctgtatttccctatgaggtgaaaaaggatggg
gcagcagggctgcccagcaatcccagagctccaggcgcccacagaagttaa

DBGET integrated database retrieval system