KEGG   Bos indicus (zebu cattle): 109574499
Entry
109574499         CDS       T04792                                 

Gene name
CD7
Definition
(RefSeq) T-cell antigen CD7 isoform X1
  KO
K06457  T-cell surface glycoprotein CD7
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109574499 (CD7)
CD molecules [BR:biu04090]
 Proteins
  109574499 (CD7)
SSDB
Motif
Pfam: V-set Ig_3 Ig_2 I-set GP11
Other DBs
NCBI-GeneID: 109574499
NCBI-ProteinID: XP_019838104
UniProt: A0A6P5DK20
LinkDB
Position
19
AA seq 202 aa
MVGLLGLLLFPLLQAVGEVWQSPRKTIALEGDSVNITCSTPGTLHGIYLKKTWPNNSDVI
YYEDGLEPTVDPQFQGRIAYSGLQSNLTISLYHLQLADTGGYTCVAIMDDKIFGPGTLVM
VTDQLPQAANTCQESWPIHFALPTALAVGFFLIGLGLGAVCVLIRTQIQKLCCAKDKSPV
FVIYEDMSHSRCNTMSIPNQYQ
NT seq 609 nt   +upstreamnt  +downstreamnt
atggttgggctcctggggctcctgctgttccccttgctccaggccgttggagaggtgtgg
cagtccccccgcaaaacgatcgctttagagggggactccgtcaacatcacctgctccacc
ccggggaccctgcatggcatctacctgaaaaaaacgtggccgaacaacagcgatgtgatt
tactatgaagatgggttggagcccaccgtggacccgcagttccagggccgcattgcctac
tcagggctgcaaagcaacctgaccatcagcttgtaccacctgcagttggctgacaccggt
ggctatacctgtgtggccatcatggatgataagatctttggtcccggcaccttggtcatg
gtgacagaccaactgccccaggcagcgaacacatgccaggagtcttggccgatacacttt
gccctccccacggccctggctgtgggcttcttcctcatcgggctgggactgggagcagtg
tgtgtgctgataagaacacagatccagaaactctgctgtgcgaaggataagagcccagtg
ttcgtgatctatgaggacatgtcccacagccgctgtaacaccatgtccatccccaaccag
taccagtga

DBGET integrated database retrieval system