KEGG   Bos indicus (zebu cattle): 109574543
Entry
109574543         CDS       T04792                                 

Definition
(RefSeq) somatotropin
  KO
K05438  growth hormone
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04080  Neuroactive ligand-receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04630  JAK-STAT signaling pathway
biu04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109574543
   04151 PI3K-Akt signaling pathway
    109574543
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109574543
   04060 Cytokine-cytokine receptor interaction
    109574543
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    109574543
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109574543
Cytokines and growth factors [BR:biu04052]
 Cytokines
  CSF and other factors
   109574543
SSDB
Motif
Pfam: Hormone_1 XTBD
Other DBs
NCBI-GeneID: 109574543
NCBI-ProteinID: XP_019838159
UniProt: A5YVX0
LinkDB
Position
19
AA seq 217 aa
MMAAGPRTSLLLAFALLCLPWTQVVGAFPAMSLSGLFANAVLRAQHLHQLAADTFKEFER
TYIPEGQRYSIQNTQVAFCFSETIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLS
RVFTNSLVFGTSDRVYEKLKDLEEGILALMRELEDGTPRAGQILKQTYDKFDTNMRSDDA
LLKNYGLLSCFRKDLHKTETYLRVMKCRRFGEASCAF
NT seq 654 nt   +upstreamnt  +downstreamnt
atgatggctgcaggcccccggacctccctgctcctggctttcgccctgctctgcctgccc
tggactcaggtggtgggcgccttcccagccatgtccttgtccggcctgtttgccaacgct
gtgctccgggctcagcacctgcaccagctggctgctgacaccttcaaagagtttgagcgc
acctacatcccggagggacagagatactccatccagaacacccaggttgccttctgcttc
tctgaaaccatcccggcccccacgggcaagaatgaggcccagcagaaatcagacttggag
ctgcttcgcatctcactgctcctcatccagtcgtggcttgggcccctgcagttcctcagc
agagtcttcaccaacagcttggtgtttggcacctcggaccgtgtctatgagaagctgaag
gacctggaggaaggcatcctggccctgatgcgggagctggaagatggcaccccccgggct
gggcagatcctcaagcagacctatgacaaatttgacacaaacatgcgcagtgacgacgcg
ctgctyaagaactacggtctgctctcctgcttccggaaggacctgcataagacggagacg
tacctgcgggtcatgaagtgccgccgcttcggggaggccagctgtgccttctag

DBGET integrated database retrieval system