KEGG   Bos indicus (zebu cattle): 109574556Help
Entry
109574556         CDS       T04792                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00020  Citrate cycle (TCA cycle)
biu00190  Oxidative phosphorylation
biu01100  Metabolic pathways
biu01200  Carbon metabolism
biu04714  Thermogenesis
biu04932  Non-alcoholic fatty liver disease (NAFLD)
biu05010  Alzheimer disease
biu05012  Parkinson disease
biu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    109574556 (SDHB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    109574556 (SDHB)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    109574556 (SDHB)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    109574556 (SDHB)
   05012 Parkinson disease
    109574556 (SDHB)
   05016 Huntington disease
    109574556 (SDHB)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    109574556 (SDHB)
Enzymes [BR:biu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     109574556 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_7
Motif
Other DBs
NCBI-GeneID: 109574556
NCBI-ProteinID: XP_019838177
LinkDB All DBs
Position
2
AA seq 285 aa AA seqDB search
MSGAKMAAVVALSLRRRFPAAALGGARLQACRGAQTAAAAAPRIKKFAIYRWDPDKTGDK
PHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTR
RIDTNLSKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQGGKEQYLQSIE
DREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQ
DPFSLYRCHTIMNCTQTCPKGLNPGKAIAEIKKMMATYKEKQASA
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggcgccaagatggcggcagtggtcgcgctctccttgaggcgccggttcccggcc
gccgccctcggcggggcccgcctgcaggcctgccgtggggctcagacagctgcagccgca
gcaccccgaatcaagaaatttgccatctatcgatgggacccggacaagactggagacaaa
cctcacatgcaaacttatgagattgatttgaataactgtggtcctatggtgctggatgct
ctaatcaagattaagaatgaaattgattccaccctgaccttccggagatcatgcagagaa
ggcatctgcggctcctgtgccatgaacatcaacggaggcaacactctggcgtgcacccgc
aggatcgacaccaacctcagcaaagtttccaaaatctaccctctgccacacatgtatgtg
ataaaggaccttgttcctgatttgagcaacttctatgctcagtacaagtccatcgagcct
tacttaaagaagaaggatgagtcccagggaggcaaggagcagtatctgcagtccatagaa
gaccgtgagaaactggacgggctctatgagtgtatcctctgcgcctgctgcagcaccagt
tgcccgagctactggtggaacggagacaagtacctgggccccgccgtgctcatgcaggcc
tatcgctggatgatcgactccagagacgacttcacggaggagcgcctggccaagctgcag
gaccccttctctctctaccgctgccacaccatcatgaactgcacgcagacctgccccaag
gggctgaatcctgggaaagctattgctgaaatcaagaagatgatggcaacctataaagag
aagcaggcttctgcttaa

DBGET integrated database retrieval system