KEGG   Bos indicus (zebu cattle): 109574578
Entry
109574578         CDS       T04792                                 

Definition
(RefSeq) eotaxin
  KO
K16597  C-C motif chemokine 11
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04061  Viral protein interaction with cytokine and cytokine receptor
biu04062  Chemokine signaling pathway
biu04657  IL-17 signaling pathway
biu05310  Asthma
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109574578
   04061 Viral protein interaction with cytokine and cytokine receptor
    109574578
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    109574578
   04062 Chemokine signaling pathway
    109574578
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    109574578
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109574578
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Chemokines
   109574578
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 109574578
NCBI-ProteinID: XP_019838193
UniProt: A0A6P5DJ01
LinkDB
Position
19
AA seq 97 aa
MKVSAVLLCLLLTATLCSIQVLAQPASIPTICCFNMSKKKISIQRLQSYRKITSSKCPQK
AVIFNTKQNKKICVDPQEKWVQNAMEYLNQKSQTLKS
NT seq 294 nt   +upstreamnt  +downstreamnt
atgaaggtctctgcagtgctcctgtgtctgctgctcacagccaccctctgcagcatccag
gtgttggctcagccagcttctattccaaccatctgctgctttaatatgtctaaaaagaag
atctccattcagcgactgcagagctacagaaaaatcacgagcagcaaatgtcctcagaaa
gctgtgatattcaacaccaaacagaacaagaaaatctgtgtcgatccccaggagaagtgg
gtccagaatgccatggagtacctgaaccaaaaatcccaaactttaaagtcataa

DBGET integrated database retrieval system