KEGG   Bos indicus (zebu cattle): 109574780Help
Entry
109574780         CDS       T04792                                 

Gene name
HTR1A
Definition
(RefSeq) 5-hydroxytryptamine receptor 1A
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04024  cAMP signaling pathway
biu04080  Neuroactive ligand-receptor interaction
biu04726  Serotonergic synapse
biu04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    109574780 (HTR1A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109574780 (HTR1A)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    109574780 (HTR1A)
  09157 Sensory system
   04742 Taste transduction
    109574780 (HTR1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:biu04030]
    109574780 (HTR1A)
G protein-coupled receptors [BR:biu04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    109574780 (HTR1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 109574780
NCBI-ProteinID: XP_019838304
LinkDB All DBs
Position
20
AA seq 422 aa AA seqDB search
MDVLSPGQGNNTTSSQGPFGTRGNATGISDVTFSYQVITSLVLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAITDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVDKKAANH
RLAASPAPQPRKSVSGESDSRDWRQGTENKVTGAPCANGAVRQGEEGAALEVIEVHRVGN
SKEHLPLPSEGGAVPYVPASFEKKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP
FFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC
RR
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggatgtgctcagccccggacagggcaataacaccacgtcgtcccagggtcccttcggg
acacgcggcaacgctactggcatctccgacgtgaccttcagctatcaagtaatcacctct
ctagtgctgggcacgctcatcttctgcgcggtgctgggcaatgcgtgtgtagtggcggcc
atcgccctggagcgctccctgcagaacgtggcgaactatctcataggctcgctggccatc
accgacctcatggtgtcggtgctggttctgcccatggccgcgttgtaccaggtgctcaac
aagtggactctgggacaggtcacctgtgacctgttcatcgccctcgacgtactgtgctgc
acctcgtccattctgcacctgtgcgctatcgctctggatagatactgggccatcaccgac
cccatcgactacgtgaacaagaggacgccccggcgcgccgctgcgctcatctcgctcacc
tggctcattggcttcctcatctccatcccgcccatgctgggctggcgcaccccggaagac
cgctcggacccggacgcgtgcactatcagcaaggaccacggctacactatttactccacc
ttcggcgctttctacatccctctgctgctcatgctggttctctacgggcgcatctttcga
gccgcgcgattccgcattcgcaagacagttaagaaggtggacaagaaggcagccaaccac
cgtcttgcggcatcgccggccccgcagcccagaaagagcgtgagtggtgagtcggatagc
agagactggaggcagggcacggagaacaaggtaacaggggctccgtgcgccaatggagcc
gtgaggcagggcgaagaaggcgccgccctggaggtgatcgaagtgcaccgggtgggcaac
tccaaagagcaccttccgctrcccagcgaaggcggtgctgtcccctacgtccccgcctcc
ttcgagaagaaaaatgagcgcaacgccgaggccaagcgcaagatggccctggcccgcgag
aggaagacggtgaagactctgggcatcatcatgggcaccttcatcctctgctggttgccc
ttcttcatcgtggccctagtcctgcccttctgcgaaagcagctgccacatgcctaccctg
ttgggggccataatcaactggctgggctactccaactctctgcttaaccctgtcatttac
gcctacttcaacaaggacttccaaaacgcgtttaagaagatcatcaagtgcaagttctgc
cgccgatga

DBGET integrated database retrieval system