KEGG   Bos indicus (zebu cattle): 109574865
Entry
109574865         CDS       T04792                                 

Gene name
SKP2
Definition
(RefSeq) S-phase kinase-associated protein 2 isoform X1
  KO
K03875  F-box and leucine-rich repeat protein 1 (S-phase kinase-associated protein 2)
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04068  FoxO signaling pathway
biu04110  Cell cycle
biu04120  Ubiquitin mediated proteolysis
biu04150  mTOR signaling pathway
biu05169  Epstein-Barr virus infection
biu05200  Pathways in cancer
biu05203  Viral carcinogenesis
biu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    109574865 (SKP2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109574865 (SKP2)
   04150 mTOR signaling pathway
    109574865 (SKP2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109574865 (SKP2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109574865 (SKP2)
   05203 Viral carcinogenesis
    109574865 (SKP2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    109574865 (SKP2)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    109574865 (SKP2)
Ubiquitin system [BR:biu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     109574865 (SKP2)
SSDB
Motif
Pfam: F-box-like F-box LRR_4 F-box_5 LRR_8
Other DBs
NCBI-GeneID: 109574865
NCBI-ProteinID: XP_019838429
UniProt: A0A6P5DKX4
LinkDB
Position
20
AA seq 436 aa
MHAFKTPEAVDAMHRKHLQEIPDQSSNVTTSFTWGWDSSKTSELLSGXGVSALEKEEVDS
ENIPQELLSNLGHPQSPPRKRLKSKGNDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGI
FSCLCLPELLKVSSVCKRWYHLAFDESLWQTVDLAGRNLYPDVVGRLLSRGVVAFRCPRS
FMDQPLVEHFSPFRLQHLDLSNSVIDASTLHGLLSHCSKLQNLSLEGLRLSDPVVDNLAQ
NTNLLRLNLSGCSGFSESALKTLLSSCSRLDELNLSWCYDFTEKHVQMAVAHVSKTITQL
NLSGYRKNLQRSDVSTLVGRCPNLVHLDLSDSVMLKNDCFPEFYQLNYLQHLSLSRCYDI
IPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQE
IWGIKCRLSLEKPSCL
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgcacgcatttaaaactcccgaagctgtggacgccatgcacaggaaacacctccaggag
atacccgaccagagtagcaacgttaccaccagtttcacgtggggatgggattctagcaag
acttctgaactgctttcaggcaygggggtctccgccctggagaaggaggaggtggatagt
gagaacatcccccaggaactgctttcaaacctgggccacccacaragccccccacgaaaa
cggctgaaaagcaaagggaatgacaaggactttgtgattgtccgcagacctaagctaaac
cgagagaactttccaggtgtttcttgggactcccttccagacgagctgctcttaggaatc
ttttcctgtctgtgcctccctgaactcctgaaagtctccagtgtttgtaagagatggtat
catctagcatttgacgagtctctctggcagactgtagacctcgcgggcagaaacctctac
ccagatgtggttggtcggcttttgtcccgaggggtggttgccttccgctgtccacgatca
tttatggaccaaccgttagttgaacatttcagccctttccgactacagcacctggacctg
tcgaactctgtgatcgatgcgtctaccctgcacggccttctatctcactgctccaagttg
cagaatctcagcctggaaggcctccgactttcagatcccgttgttgataatcttgctcag
aacacaaatttactgcgactaaacctttctgggtgttctggattctctgaatctgccctg
aagactttgctgagcagctgttccagactggatgaactgaacctctcctggtgctatgat
ttcactgaaaagcatgtacagatggccgttgcacatgtgtcaaagaccatcacccagctg
aatctcagcgggtaccgaaagaatctgcagagatcagatgtctctaccttagttggaaga
tgtcccaatcttgtccacctagacttaagcgatagtgtcatgctgaaaaatgactgcttt
ccagaattttaccaactcaactacctccaacacctgtcactcagtcggtgctatgacata
atacctgaaactttacttgaacttggagaaattcccacattaaaaacactacaagtcttt
ggaatcgtaccagacggtacccttcaattgttaaaggaagccctccctcatctacagatt
aattgctcccatttcaccaccatcgccaggccgaccattggcaacaagaagaaccaagag
atatggggcatcaaatgccgactgtcactggagaagcccagttgcctatga

KEGG   Bos indicus (zebu cattle): 109579088
Entry
109579088         CDS       T04792                                 

Definition
(RefSeq) S-phase kinase-associated protein 2-like
  KO
K03875  F-box and leucine-rich repeat protein 1 (S-phase kinase-associated protein 2)
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04068  FoxO signaling pathway
biu04110  Cell cycle
biu04120  Ubiquitin mediated proteolysis
biu04150  mTOR signaling pathway
biu05169  Epstein-Barr virus infection
biu05200  Pathways in cancer
biu05203  Viral carcinogenesis
biu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    109579088
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109579088
   04150 mTOR signaling pathway
    109579088
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109579088
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109579088
   05203 Viral carcinogenesis
    109579088
  09162 Cancer: specific types
   05222 Small cell lung cancer
    109579088
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    109579088
Ubiquitin system [BR:biu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     109579088
SSDB
Motif
Pfam: LRR_4 LRR_8
Other DBs
NCBI-GeneID: 109579088
NCBI-ProteinID: XP_019844149
UniProt: A0A6P5E1E0
LinkDB
Position
26
AA seq 210 aa
MDQPSVDHFSNLAQNTNLPRLNLSGCSGFSESALKTLLSNCSRLDELNLSWCYDFTEKPV
QVAVAHVSETITQLKLSGYRKNLQRSDVSTLVGRCPNLVHLDLSDSVMLKNDCFPEFYQL
DYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFT
TIARPTIGNKKKQEIWGIKCLLSLEKPSCL
NT seq 633 nt   +upstreamnt  +downstreamnt
atggaccaaccgtcagttgatcatttcagtaatcttgctcagaacacaaatttaccgcga
ctaaacctttctgggtgttctggattctctgaatctgccctgaagactttgctgagcaac
tgttccagattggatgaactgaacctctcttggtgctatgatttcactgaaaagcctgta
caggtggctgttgcacatgtgtcagagactatcacccagctgaagctcagcgggtaccga
aagaatctgcagagatcagatgtctctaccttagttggaagatgtcccaaccttgtccac
ctagacttaagtgatagtgtcatgctgaaaaatgactgctttccagaattttaccaactc
gattacctccaacatctatcactcagtcggtgctatgacataatacctgaaactttactt
gaacttggagaaattcccacattaaaaacactacaagtctttggaattgtaccagatggt
acccttcaactgttaaaggaagccctccctcatctacagattaattgctcccatttcacc
accatcgccaggccaaccattggcaacaagaagaagcaagagatatggggcatcaaatgc
ctactgtcactggagaagcccagttgcctatga

DBGET integrated database retrieval system