KEGG   Bos indicus (zebu cattle): 109575020
Entry
109575020         CDS       T04792                                 

Gene name
IL7R
Definition
(RefSeq) interleukin-7 receptor subunit alpha isoform X1
  KO
K05072  interleukin 7 receptor
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04068  FoxO signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04630  JAK-STAT signaling pathway
biu04640  Hematopoietic cell lineage
biu05200  Pathways in cancer
biu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109575020 (IL7R)
   04068 FoxO signaling pathway
    109575020 (IL7R)
   04151 PI3K-Akt signaling pathway
    109575020 (IL7R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109575020 (IL7R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109575020 (IL7R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109575020 (IL7R)
  09163 Immune disease
   05340 Primary immunodeficiency
    109575020 (IL7R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109575020 (IL7R)
   04090 CD molecules [BR:biu04090]
    109575020 (IL7R)
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  IL2 receptor family
   109575020 (IL7R)
CD molecules [BR:biu04090]
 Proteins
  109575020 (IL7R)
SSDB
Motif
Pfam: FN3_7 fn3 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 109575020
NCBI-ProteinID: XP_019838649
UniProt: A0A6P5DLF5
LinkDB
Position
20
AA seq 459 aa
MTLLSIALGTLFYLLQAVSGESGYAENGDFDDAELEDYSFSCYSQLEVDGLQHLLTCMFD
DSDINSTNLEFEICGALLDXDCLNFNKLQERYFLKTKKFLLIGDSKICVKLEKKNMTCRK
VNIVKIVKPEAPFDVRVVYREGANDFVVTFNTSHLQKKYVKVLIHEVAYRQEKNENNWMR
VNLTSTKLTLLQRKLQPNAMYEIKVRSIPYANYFEGFWSEWSPSFHFRTPETNGTGETDP
VLLTISILSFFSVALMVTLACVLWKKRIKPIIWPSLPDHKKTLEQLCKKPKKNLNVSFNP
ESFLDCQIHKVDGIQAKDEAEGFLQDPLPPQPEESDKQRFRAGMQGPSWPSEQAGITPKI
FRGESPFRCLAGNASVCDAPGLLSSRSPNGREGGKSRPLVYQDLLLGPGTTNSSLPPPFP
FQPGILTLNPVAQGQPILXSLGSSQEEAYVTMSSFYQNQ
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgacacttctaagtattgctttgggtacgcttttctatttacttcaagccgtttctgga
gaaagcggctatgcagagaatggagattttgacgatgcagaactggaagactactcattc
tcatgctacagtcagctggaagtggatggactccagcacttgctgacctgcatgtttgat
gactcggacatcaacagcaccaatctggaatttgaaatatgtggggcgcttttggatrta
gattgcctgaattttaataaactgcaagagaggtatttcctcaagacaaagaaattctta
ctgattggagacagtaaaatatgtgtgaagcttgaaaaaaagaacatgacttgcagaaaa
gtgaacatagtcaagatagttaaacctgargctccttttgacgtcagagtcgtctatcgt
gagggagcaaatgactttgtggtgacatttaatacatcacacttgcagaagaagtatgtg
aaagtattaatacatgaggtagcctaccgtcaggaaaaaaatgaaaataattggatgcgt
gtgaatttaaccagtaccaagctgacactcctacagagaaaactacaacccaatgccatg
tatgagattaaagttcggtccatcccttacgccaactattttgaaggcttctggagtgaa
tggagtccaagtttccactttagaactccggagaccaayggcacaggggagacggatcct
gtgttactaactatcagcattctgagcttcttctctgtggctctgatggtcactctggcc
tgtgtcttatggaaaaaaagaattaaacctattatatggcccagtctccctgatcataag
aagactctggaacaactgtgcaagaaaccaaaaaaaaatttgaatgtgagtttcaatcct
gaaagtttcctggactgccagattcataaggtggatggcattcaagctaaagatgaagca
gaaggcttcctgcaagaccctcttcctccacagccagaagagagtgacaagcagaggttc
agagccgggatgcagggtcccagctggccctccgagcaagcaggcattacccctaaaatt
ttcagaggagagtcaccattcagatgcctggctgggaatgccagtgtgtgtgatgcccct
gggctcctctcctccaggtctcctaatggcagggaaggtggcaagagcagacctctagtg
taccaggacctgctcctcggacctggaactacaaacagctccctgccccctccgtttcca
ttccaacccggaatcctgacattgaaccctgttgcccaggggcagcccatcctcasttcc
ttgggatcaagtcaagaagaagcctatgtcaccatgtccagcttctaccaaaaccaatga

DBGET integrated database retrieval system