KEGG   Bos indicus (zebu cattle): 109575162
Entry
109575162         CDS       T04792                                 

Gene name
KIF7
Definition
(RefSeq) kinesin-like protein KIF7
  KO
K18806  kinesin family member 7
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04340  Hedgehog signaling pathway
biu05200  Pathways in cancer
biu05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    109575162 (KIF7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109575162 (KIF7)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    109575162 (KIF7)
Cytoskeleton proteins [BR:biu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     109575162 (KIF7)
SSDB
Motif
Pfam: Kinesin Microtub_bd
Other DBs
NCBI-GeneID: 109575162
NCBI-ProteinID: XP_019838759
UniProt: A0A6P5DLQ8
LinkDB
Position
21
AA seq 1254 aa
MGLEAQRLPGVEEAPVRVALRVRPLLRKELLHGHQSCLTVEPGRSRVTLGRDRHFGFHVV
LDEDAGQEAVYQACVQPLLEAFFEGFNVTVFAYGQTGSGKTYTMGEASVASLHEDEQGII
PRAMAEAFKLIDENDLLDCLVHVSYLEVYKEEFRDLLEVGTASRDIQLREDDRGNVVLCG
VKEVDVEGLDEVLSLLEMGNAARHTGATHLNRLSSRSHTIFTVTLEQRGRAPSRLPRPAA
GQLLVSKFHFVDLAGSERVLKTGSTGERLKESIQINSSLLALGNVISALGDPQRRGSHIP
YRDSKITRILKDSLGGNAKTMMIACISPSSSDFDETLNTLNYASRAQNIRNRATVNWRPE
AERGPEEAVASARGPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXAARKVRDWLCAVEGERSALSSASGPDSGIESASAEEQATQGPGGR
KEDEGPLQLLALQSQVARLEEENRDFLAALEDAMEQYKLQSDRLREQQEEMAELRLRLEL
VRPGWGAPGILQGLPPGSFVPRPHTAPLGGAHTHVLGMVPPACIPGDEVGPESRGEQMKN
GRENPCKCWGLTEVWESHGGGAAMLQGGVSGAEYTPVLPGKAAQALNRQHSQRIQELERE
AERVRAELSEGQRQLRELEGREPQDAGERSQLQEFRKRVAAAQNQVQVLKEKKQATERLA
SLSAQSEKRLQELERNVQLMRQQQGQLQRRLREETEQKRRLEAEMNKRQHRVKELELKHE
QQQKILKIKTEEIAAFQRKRRSGSNGSVVSLEQQQKIEEQKKWLDQEMEKVLQQRRALEE
LGEELHKREAILAKKEALMQEKTGLESKRLRSSQALNEDIVRVSSRLEHLEKELSEKSGQ
LRQGSAQSQQQIRGEIDALRQEKDSLLKQRLEIDSKLRQGSLLSPEEERTLFQLDEAIEA
LDAAIEYKNEAITCRQRVLRASASLLSQCEMNLMAKLSYLSSSETRALLCKYFDKVVTLR
EEQHQQQVAFSELELQLEEQQRLVYWLEAALERQRLEMDRQLTLQQRGHEQHVQLLLQQS
RDHLGEGLADSRRQYETRIQALEKELGRHVRLNQELKQKLSSLSAASQSRVMGGEKRTPC
LENRQAPGSEDELYPAPEPLWQPTGMEGAPRPREEMRDLVHAPLPLTWKRSSLCSEEQGS
PEELRQRDAAELPVGRVLPVGEAGLPWNLGPLAKPRRELRRVSPGMIDVRKNPL
NT seq 3765 nt   +upstreamnt  +downstreamnt
atggggctggaggcccagaggttgccaggggttgaggaggcccccgtgagggtggccctt
cgagtgcgcccactcctgcgcaaggagctgctgcacgggcaccagagctgcctgacggtg
gagccggggcgcagccgggtcaccctgggccgagaccgccactttggcttccacgtggtg
ctggatgaggacgccgggcaggaggctgtgtaccaggcttgtgtacagccccttctcgag
gctttctttgaaggcttcaatgtcaccgtctttgcctacggtcagacgggctccgggaag
acgtacaccatgggggaggccagtgtggcctcccttcacgaggacgagcagggcatcatc
ccacgggccatggccgaggccttcaagctgattgatgagaatgacctgttggactgtctg
gtgcacgtgtcctacctggaagtgtacaaggaggagttccgagacctgctggaggtgggc
accgccagccgggacatccagctccgggaggacgatcgtgggaatgttgtgctgtgtggg
gtgaaggaagtggacgtggagggcctggacgaggtgctgagcctcctggagatgggcaat
gcagcgcggcacacgggagccacacacctcaaccgcctctccagccgctcccacaccatc
ttcaccgtgaccctggagcagcggggtcgcgcccccagccgcctgccccgacctgcggcc
ggccagctgcttgtctccaagttccactttgtggacttggcgggctcggagagggtgctc
aagacaggcagcacaggcgagcgactcaaggagagcatccagatcaacagcagcctcttg
gcgctaggcaacgtcatcagtgccctgggtgatccccagcgccggggcagccacatccct
taccgggactccaagatcacccggatcctcaaagactccctgggcgggaacgccaagacg
atgatgatcgcctgcatcagcccttcctcctccgactttgacgagaccctcaacaccctc
aactacgccagccgcgcccagaatattcgaaaccgcgccactgtcaactggcggcccgag
gctgagcgggggccggaggaggccgtggccagcgcccgtgggccgccnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnncgccgcccgcaaggtg
cgcgactggctgtgcgccgtcgagggcgagcgcagcgccctgagctccgcctccgggccc
gacagcggcatcgagagcgcctctgccgaggagcaggccacccagggacccggcgggcga
aaggaagatgaggggccgctgcagctgctggccctgcagagccaggtggcccggctggaa
gaggagaaccgagactttctggctgcgctggaggacgccatggagcagtacaaacttcag
agtgaccgtcttcgtgagcagcaggaggagatggcagagctgcgactgcggctggagctg
gtgcggccaggctggggggccccagggatcttgcagggcttgcctccagggtcttttgtg
ccccggcctcacacagcccccctgggaggtgcccacacccatgtgctgggcatggttccc
cccgcctgcattcctggagatgaagttggccctgagagccggggagagcagatgaaaaat
ggcagggagaatccttgtaagtgctgggggctgacagaggtctgggaaagccacggggga
ggagctgcgatgcttcagggaggggtctccggtgctgagtacaccccggttcttccaggg
aaggctgcccaggccttgaaccgtcagcacagccagcgcatccaggagctggagcgggag
gcggagcgggtgcgggcagagctgagcgagggccagaggcagctgcgggagctcgagggc
agggagccccaggacgctggtgagcgctcgcagctccaggagttccgcaagagggttgct
gccgctcagaaccaagtgcaggtactgaaggagaagaagcaggcgacggagcggctggca
tcactgtcggcgcagagtgagaagcggctgcaggagctggagaggaacgtgcagctcatg
cggcagcagcaggggcagctgcagcggcggcttcgcgaggagacagagcagaagcgccgc
ctggaggcggagatgaacaagcggcagcaccgtgtcaaggagctggagctgaagcacgag
cagcagcagaagatcctgaagatcaagacagaagagatcgcggcatttcagaggaagcgg
cgcagcggaagcaacggctctgtggtcagcctggagcagcagcagaagattgaggagcag
aagaagtggctggaccaggaaatggagaaggtcctgcagcagcggcgggcactggaggag
ctgggggaggagctccacaagcgggaggccatcctggccaagaaggaggccctgatgcag
gagaagacggggctggagagcaagcggcttcggtccagccaggccctcaacgaggacatt
gtgcgagtatccagccggctggagcacctggagaaggagctgtccgagaagagcgggcag
ctgcggcagggcagtgcccagagccagcagcagatccgtggggagattgacgcgctgcgc
caggagaaggactcgctgctgaaacagcggctggagattgacagcaagctgaggcagggc
agcctgctgtcgcctgaggaggagcggacactgttccagctggatgaggccattgaggcc
ctggacgccgccatcgagtacaagaacgaggccatcacgtgccgccagcgagtgctgcgg
gcctcagcctccttgctgtcccagtgcgagatgaacctcatggccaagctcagctacctc
tcgtcctcggagacccgagcccttctctgcaagtacttcgacaaagtggtgacactccga
gaggagcagcaccagcagcaggtggccttctcggagctcgagttgcagctggaggagcag
cagaggctggtgtactggctggaggcggccctggagcggcagcgcctggagatggaccgc
cagctgaccctgcagcagaggggacatgagcagcacgtgcagctgctgctgcagcagagc
cgagaccatcttggcgaagggctggcggacagcaggaggcagtacgagaccagaatccaa
gctctggagaaggagctgggccgccacgtgcggctgaaccaggagctgaagcagaagctc
agtagcctgagtgctgccagccagagcagggtgatgggtggggagaagaggaccccgtgc
ctggagaacagacaagcccctggaagcgaggatgagctctacccagcgcctgagcctctc
tggcagcccaccggcatggagggtgccccccgcccacgggaggagatgcgggacttggtc
cacgccccgttaccgttgacgtggaaacgctcgagcctgtgcagtgaggagcagggctct
cctgaggagctgcggcagcgggacgccgctgagctcccagtggggcgggtgctgcctgtg
ggtgaggcgggtctgccctggaacctcgggcccttggccaagccccggcgggaactgcgg
agggtcagcccagggatgatcgacgtcaggaaaaaccccctgtag

DBGET integrated database retrieval system