Bos indicus (zebu cattle): 109575581 Help Entry 109575581         CDS       T04792                                  Gene name NFKBIA Definition (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism biu  Bos indicus (zebu cattle) Pathway biu04024   cAMP signaling pathway biu04062   Chemokine signaling pathway biu04064   NF-kappa B signaling pathway biu04210   Apoptosis biu04380   Osteoclast differentiation biu04620   Toll-like receptor signaling pathway biu04621   NOD-like receptor signaling pathway biu04622   RIG-I-like receptor signaling pathway biu04623   Cytosolic DNA-sensing pathway biu04625   C-type lectin receptor signaling pathway biu04657   IL-17 signaling pathway biu04658   Th1 and Th2 cell differentiation biu04659   Th17 cell differentiation biu04660   T cell receptor signaling pathway biu04662   B cell receptor signaling pathway biu04668   TNF signaling pathway biu04722   Neurotrophin signaling pathway biu04920   Adipocytokine signaling pathway biu04926   Relaxin signaling pathway biu04931   Insulin resistance biu05132   Salmonella infection biu05134   Legionellosis biu05135   Yersinia infection biu05140   Leishmaniasis biu05142   Chagas disease biu05145   Toxoplasmosis biu05160   Hepatitis C biu05161   Hepatitis B biu05162   Measles biu05163   Human cytomegalovirus infection biu05164   Influenza A biu05166   Human T-cell leukemia virus 1 infection biu05167   Kaposi sarcoma-associated herpesvirus infection biu05168   Herpes simplex virus 1 infection biu05169   Epstein-Barr virus infection biu05170   Human immunodeficiency virus 1 infection biu05171   Coronavirus disease - COVID-19 biu05200   Pathways in cancer biu05203   Viral carcinogenesis biu05215   Prostate cancer biu05220   Chronic myeloid leukemia biu05222   Small cell lung cancer biu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     109575581 (NFKBIA)    04668 TNF signaling pathway     109575581 (NFKBIA)    04024 cAMP signaling pathway     109575581 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     109575581 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     109575581 (NFKBIA)    04621 NOD-like receptor signaling pathway     109575581 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     109575581 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     109575581 (NFKBIA)    04625 C-type lectin receptor signaling pathway     109575581 (NFKBIA)    04660 T cell receptor signaling pathway     109575581 (NFKBIA)    04658 Th1 and Th2 cell differentiation     109575581 (NFKBIA)    04659 Th17 cell differentiation     109575581 (NFKBIA)    04657 IL-17 signaling pathway     109575581 (NFKBIA)    04662 B cell receptor signaling pathway     109575581 (NFKBIA)    04062 Chemokine signaling pathway     109575581 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     109575581 (NFKBIA)    04926 Relaxin signaling pathway     109575581 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     109575581 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     109575581 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109575581 (NFKBIA)    05203 Viral carcinogenesis     109575581 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     109575581 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     109575581 (NFKBIA)    05215 Prostate cancer     109575581 (NFKBIA)    05222 Small cell lung cancer     109575581 (NFKBIA)   09167 Endocrine and metabolic disease    04931 Insulin resistance     109575581 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     109575581 (NFKBIA)    05135 Yersinia infection     109575581 (NFKBIA)    05134 Legionellosis     109575581 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     109575581 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     109575581 (NFKBIA)    05161 Hepatitis B     109575581 (NFKBIA)    05160 Hepatitis C     109575581 (NFKBIA)    05171 Coronavirus disease - COVID-19     109575581 (NFKBIA)    05164 Influenza A     109575581 (NFKBIA)    05162 Measles     109575581 (NFKBIA)    05168 Herpes simplex virus 1 infection     109575581 (NFKBIA)    05163 Human cytomegalovirus infection     109575581 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     109575581 (NFKBIA)    05169 Epstein-Barr virus infection     109575581 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     109575581 (NFKBIA)    05140 Leishmaniasis     109575581 (NFKBIA)    05142 Chagas disease     109575581 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:biu03000]     109575581 (NFKBIA)    04131 Membrane trafficking [BR:biu04131]     109575581 (NFKBIA) Transcription factors [BR:biu03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     109575581 (NFKBIA) Membrane trafficking [BR:biu04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     109575581 (NFKBIA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 Motif Other DBs NCBI-GeneID:  109575581 NCBI-ProteinID:  XP_019839367 UniProt:  A0A6P5DQQ2 LinkDB All DBs Position 21 AA seq 314 aa AA seqDB search MFQPAEPGQDWAMEGPRDALKKERLLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAP RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAEALLEAXCDPELRDFRGNTPLHLACEQGCLASVGVLTQPRGTQHLHSILQATN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQTLPESEDEESYDTESEFTEDEL PYDDCVLGGQRLTL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgttccagcctgccgagcccggccaagattgggccatggagggcccccgggacgcgctc aagaaggagcggctgctggacgaccgccacgacagcggcctggactccatgaaggacgag gagtatgagcagatggtgaaggagctgcgagagatccgcctcgagccgcaggaggcgccg cgcggcgccgagccctggaaacagcagctcaccgaggacggagactcgttcctgcactta gccatcatccatgaagagaaggcgctgaccatggaagtggtccgccaagtgaagggagac ctggccttcctcaacttccagaacaacctgcagcagacgccactccacttggctgtgatc actaaccagccagaaatcgctgaggcacttctggaagctgrctgtgatcctgagctgcga gactttcgaggaaatacccccctacaccttgcctgtgagcagggctgcctggccagtgtg ggagtcctgactcagccccgggggacccagcacctccactccatcctgcaggccaccaac tacaatggccacacgtgtctgcacttggcctctattcatggctacctgggcatcgtggag ctgttggtgtccttgggcgctgatgtcaacgctcaggagccctgcaatggccgaactgcc ctccatctggcagtggacctgcagaatcccgacctggtgtcactcctattgaagtgtggg gctgatgtcaacagagtcacctaccagggctactccccgtaccagctcacgtggggccgc cccagcacccggatacagcagcagctgggccagctgaccctagagaaccttcagacactg ccggagagcgaggatgaggagagctatgacaccgaatcagagttcacagaggacgagctt ccctacgatgactgtgtgcttggaggccagcgtctgacgttatga

DBGET integrated database retrieval system