KEGG   Bos indicus (zebu cattle): 109575620
Entry
109575620         CDS       T04792                                 

Gene name
ANPEP
Definition
(RefSeq) aminopeptidase N
  KO
K11140  aminopeptidase N [EC:3.4.11.2]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00480  Glutathione metabolism
biu01100  Metabolic pathways
biu04614  Renin-angiotensin system
biu04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    109575620 (ANPEP)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109575620 (ANPEP)
  09152 Endocrine system
   04614 Renin-angiotensin system
    109575620 (ANPEP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109575620 (ANPEP)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109575620 (ANPEP)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109575620 (ANPEP)
   04090 CD molecules [BR:biu04090]
    109575620 (ANPEP)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.2  membrane alanyl aminopeptidase
     109575620 (ANPEP)
Peptidases and inhibitors [BR:biu01002]
 Metallo peptidases
  Family M1
   109575620 (ANPEP)
Membrane trafficking [BR:biu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    109575620 (ANPEP)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   109575620 (ANPEP)
CD molecules [BR:biu04090]
 Proteins
  109575620 (ANPEP)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N DUF5700 Ost4
Other DBs
NCBI-GeneID: 109575620
NCBI-ProteinID: XP_019839426
UniProt: A0A6P5DMQ7
LinkDB
Position
21
AA seq 965 aa
MAKGFYISKALGILAILLGVAAVATIIALSVVYAQEKNKNAERGTAAPTSPTGPTTTSAT
TLDQSKPWNRYRLPTTLLPDSYRVTLRPYLTPNNNGLYIFTGSSTVRFTCKEPTDVIIIH
SKKLNYTQHSGHLAVLXGVGDTQAPEIDRTELVLLTEYLVVHLKSSLEAGKTYEMETTFQ
GELADDLAGFYRSEYMDGNVKKVLATTQMQSTDARKSFPCFDEPAMKATFNITLIHPKDL
TALSNMPPKGPSVPFDGDSNWSVTEFETTPVMSTYLLAYIVSEFTSVESVAPNDVQIRIW
ARPKATADNHGLYALNVTGPILNFFANHYNTAYPLPKSDQIALPDFNAGAMENWGLVTYR
ENALLYDPQSSSSSNKERVVTVIAHELAHQWFGNLVTLAWWNDLWLNEGFASYVEYLGAD
YAEPTWNLKDLMVPNDVYRVMAVDALVTSHPLTTPANEVNTPAQISEMFDTISYSKGASV
IRMLSNFLTEDLFKKGLASYLQTFAYQNTTYLNLWEHLQMAVENQLSIRLPDTVSAIMDR
WTLQMGFPVITVDTNTGTISQKHFLLDPNSTVTRPSQFNYLWIVPISSIRNGQPQEHYWL
RGEERNQNELFKAAADDWVLLNINVTGYYQVNYDENNWKKIQNQLMSRXENIPVINRAQV
IYDSFNLASAHMVPVTLALNNTLFLKNEMEYMPWQAAVSSLNYFKLMFDRTEVYGPMQNY
LXNQVEPIFLYFENLTKNWXEIPENLMDQYSEINAISTACSNGLPKCEELAKTLFNQWMN
NPNVNPIDPNLRSTIYCNAIAQGGQXEWDFAWXQLQQAELVNEADKLRSALACTNHVWLL
NRYLSYTLNPDLIRKQDATSTITSIASNVIGQSLAWDFIRSNWKKLFEDYGGGSFSFSNL
IQGVTRRFSTEFELQQLEEFKENNMDVGFGSGTRALEQALEKTKANINWVKENKEVVLXW
FKXHS
NT seq 2898 nt   +upstreamnt  +downstreamnt
atggccaaaggattctacatttccaaggccctgggcatcctggccattctcctgggygtg
gcggccgtggccaccatcatcgctctgtctgtggtgtacgcccaggagaagaacaagaat
gccgagcgtggcacygcggcccccacgagccccacaggcccgacaaccacctcggccacc
accttggaccagagcaagccrtggaaccgataccgcctccccacgaccctcttgcccgac
tcctatagggtgacgctgaggccctacctcactcccaacaataacggcctgtatatcttc
acgggctcaagcactgtccgcttcacctgcaaggagcccacggacgtcatcatcatccac
agcaagaagctcaactacacccagcacagtgggcacttggcggtcctgargggtgtgggg
gacacccaggcccccgaaatcgacaggaccgagctggtgttgctcacagagtacctggtg
gtccacctcaagagctccctggaagcaggcaagacgtatgagatggagaccacctttcag
ggggagctggccgaygacctggcgggcttctaccgcagcgagtacatggacggcaacgtc
aaaaaggtcctggccaccacacagatgcagtcaacagatgcccggaagtccttcccctgc
tttgacgagccygccatgaaggccacatttaacatcaccctcatccaccccaaggatctc
acagccctgtccaacatgccacccaaaggtcccagtgtcccgtttgacggagattccaac
tggagcgtcactgagtttgaaaccacgccggtaatgtccacgtacctcctggcctacatc
gtgagcgagttcacgagtgtggagtcagtggctcccaatgatgtccagatccggatctgg
gctcggccaaaagcaactgcagacaaccatggcctttacgccctgaatgtgacaggtccc
atcctgaacttctttgccaatcattacaatacagcctacccactccccaaatctgaccag
attgccctgcccgacttcaacgccggtgccatggagaactgggggctggtgacctaccgg
gagaacgcgctgctctatgaccctcagtcttcctccagcagcaacaaagagcgagtagtc
actgtgattgctcatgagctggcccaccagtggtttgggaacctggtgaccctggcctgg
tggaatgacctgtggctgaacgagggctttgcctcctatgtggagtacctgggagctgac
tatgcagagcccacctggaatctgaaagacctcatggtgccgaatgacgtgtaccgtgtg
atggccgtggacgcgctggtcacctctcacccactgaccacccctgccaacgaggtcaac
acccctgcccagatcagcgagatgttcgataccatctcctacagcaagggagcctcggtc
atccggatgctctcgaatttcctgactgaggacctgttcaagaagggcctggcgtcctac
ttgcagacctttgcctatcagaacaccacctacctgaacctgtgggagcacctgcagatg
gctgtggaaaatcagttgtccatcaggctgccagacaccgtgagtgccatcatggaccgc
tggaccctacagatgggcttccctgtcatcaccgtggatactaacacagggaccatctcc
cagaagcacttcctccttgatcccaactccaccgtcacccgcccctcacagttcaactat
ctgtggattgttcccatctcatccatcagaaatggccagccgcaagaacactactggctt
cggggcgaagagagaaaccagaatgaactcttcaaagccgcagcagacgactgggtcctg
ctgaacatcaacgtgacgggctattaccaggtgaactacgacgagaacaactggaagaag
attcagaatcagctgatgtcaaggcsggagaacatccctgtcatcaaccgggcacaggtc
atctacgacagcttcaacctggccagtgcccacatggtccctgtcaccctggcgctgaac
aacaccctcttcctgaaaaatgagatggagtacatgccctggcargccgccgtgagcagc
ctgaactacttcaagctcatgttcgaccgcacagaggtctatggccccatgcagaattac
ctcargaaccaggttgaacccatcttcctatattttgaaaatctcaccaaaaactggayt
gagatcccggaaaacctgatggaccaatacagcgagattaacgccatcagcactgcctgc
tccaatgggttgcctaagtgtgaggagctggccaaaacacttttcaaccagtggatgaat
aaccctaacgttaacccgatcgaccccaacctgcggtccaccatctactgcaacgccatc
gcccagggtggccaggmagagtgggactttgcttggmrtcagttacaacaagcagagctg
gttaatgaagctgacaaactccgctcagcgctggcctgcaccaaccacgtctggctcctg
aacaggtacctgagttacaccctgaaccccgacctcatccggaagcaggacgccacctcc
accattaccagcattgccagcaatgtcatcgggcagtctctggcctgggacttcatccgg
agcaactggaagaaactctttgaggattatggtggtggttccttttccttctccaacctc
atccagggtgtgacccgaagattctccactgagtttgagctccagcagctggaggagttc
aaggagaacaacatggacgtcggcttcggctcaggaacacgggctctggagcaagccctg
gagaagactaaagccaacatcaactgggtgaaggagaacaaggaggtggtgctamactgg
ttcaaagascacagctaa

DBGET integrated database retrieval system